Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1629615..1630141 | Replicon | chromosome |
| Accession | NZ_LR881938 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | IEU92_RS07965 | Protein ID | WP_000323025.1 |
| Coordinates | 1629615..1629902 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | IEU92_RS07970 | Protein ID | WP_000534858.1 |
| Coordinates | 1629902..1630141 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEU92_RS07920 | 1624639..1624854 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| IEU92_RS07925 | 1625608..1625823 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| IEU92_RS07930 | 1626124..1626336 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| IEU92_RS07935 | 1626391..1626480 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| IEU92_RS07940 | 1626758..1627510 | - | 753 | WP_001047135.1 | antitermination protein | - |
| IEU92_RS07945 | 1627524..1628573 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
| IEU92_RS07950 | 1628575..1628853 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| IEU92_RS07955 | 1628920..1629171 | - | 252 | WP_000980994.1 | hypothetical protein | - |
| IEU92_RS07960 | 1629388..1629543 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| IEU92_RS07965 | 1629615..1629902 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| IEU92_RS07970 | 1629902..1630141 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| IEU92_RS07975 | 1630166..1630471 | + | 306 | WP_001326990.1 | hypothetical protein | - |
| IEU92_RS07980 | 1630674..1631006 | + | 333 | WP_001301033.1 | protein FlxA | - |
| IEU92_RS07985 | 1631443..1631592 | - | 150 | WP_011443592.1 | hypothetical protein | - |
| IEU92_RS07990 | 1631627..1631905 | - | 279 | Protein_1560 | hypothetical protein | - |
| IEU92_RS07995 | 1631889..1632119 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| IEU92_RS08000 | 1632203..1632610 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| IEU92_RS08005 | 1632777..1632932 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| IEU92_RS08010 | 1633092..1633310 | + | 219 | WP_001171942.1 | hypothetical protein | - |
| IEU92_RS08015 | 1633878..1634066 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| IEU92_RS08020 | 1634063..1634254 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| IEU92_RS08025 | 1634347..1635114 | + | 768 | Protein_1567 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1615271..1648732 | 33461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T289514 WP_000323025.1 NZ_LR881938:c1629902-1629615 [Escherichia coli str. K-12 substr. MG1655]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|