Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1519123..1519649 | Replicon | chromosome |
Accession | NZ_CP102379 | ||
Organism | Escherichia coli strain BM28 lysU |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NR350_RS07425 | Protein ID | WP_000323025.1 |
Coordinates | 1519123..1519410 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NR350_RS07430 | Protein ID | WP_000534858.1 |
Coordinates | 1519410..1519649 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR350_RS07375 (1514147) | 1514147..1514362 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
NR350_RS07380 (1514582) | 1514582..1514752 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
NR350_RS07385 (1515116) | 1515116..1515331 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
NR350_RS07390 (1515632) | 1515632..1515844 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
NR350_RS07395 (1515899) | 1515899..1515988 | + | 90 | WP_120795389.1 | hypothetical protein | - |
NR350_RS07400 (1516266) | 1516266..1517018 | - | 753 | WP_001047135.1 | antitermination protein | - |
NR350_RS07405 (1517032) | 1517032..1518081 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
NR350_RS07410 (1518083) | 1518083..1518361 | - | 279 | WP_012304870.1 | hypothetical protein | - |
NR350_RS07415 (1518428) | 1518428..1518679 | - | 252 | WP_000980994.1 | protein Rem | - |
NR350_RS07420 (1518896) | 1518896..1519051 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
NR350_RS07425 (1519123) | 1519123..1519410 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NR350_RS07430 (1519410) | 1519410..1519649 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NR350_RS07435 (1519674) | 1519674..1519979 | + | 306 | WP_001326990.1 | protein YdfV | - |
NR350_RS07440 (1520182) | 1520182..1520514 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
NR350_RS07445 (1520951) | 1520951..1521100 | - | 150 | WP_011443592.1 | protein YdfW | - |
NR350_RS07450 (1521135) | 1521135..1521413 | - | 279 | Protein_1454 | hypothetical protein | - |
NR350_RS07455 (1521397) | 1521397..1521627 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
NR350_RS07460 (1521711) | 1521711..1522118 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
NR350_RS07465 (1522285) | 1522285..1522440 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
NR350_RS07470 (1522442) | 1522442..1522570 | + | 129 | WP_000344964.1 | protein YdfB | - |
NR350_RS07475 (1522600) | 1522600..1522818 | + | 219 | WP_001171942.1 | protein YdfC | - |
NR350_RS07480 (1523386) | 1523386..1523574 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
NR350_RS07485 (1523571) | 1523571..1523762 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
NR350_RS07490 (1523855) | 1523855..1524622 | + | 768 | Protein_1462 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1503513..1538240 | 34727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T253541 WP_000323025.1 NZ_CP102379:c1519410-1519123 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|