Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1732987..1733513 | Replicon | chromosome |
Accession | NZ_CP110016 | ||
Organism | Escherichia coli strain HE_100 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | OLR74_RS08625 | Protein ID | WP_000323025.1 |
Coordinates | 1732987..1733274 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | OLR74_RS08630 | Protein ID | WP_000534858.1 |
Coordinates | 1733274..1733513 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLR74_RS08575 (1728011) | 1728011..1728226 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
OLR74_RS08580 (1728446) | 1728446..1728616 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
OLR74_RS08585 (1728980) | 1728980..1729195 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
OLR74_RS08590 (1729496) | 1729496..1729708 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
OLR74_RS08595 (1729763) | 1729763..1729852 | + | 90 | WP_120795389.1 | hypothetical protein | - |
OLR74_RS08600 (1730130) | 1730130..1730882 | - | 753 | WP_001047135.1 | antitermination protein | - |
OLR74_RS08605 (1730896) | 1730896..1731945 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
OLR74_RS08610 (1731947) | 1731947..1732225 | - | 279 | WP_012304870.1 | hypothetical protein | - |
OLR74_RS08615 (1732292) | 1732292..1732543 | - | 252 | WP_000980994.1 | protein Rem | - |
OLR74_RS08620 (1732760) | 1732760..1732915 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
OLR74_RS08625 (1732987) | 1732987..1733274 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
OLR74_RS08630 (1733274) | 1733274..1733513 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
OLR74_RS08635 (1733538) | 1733538..1733843 | + | 306 | WP_001326990.1 | protein YdfV | - |
OLR74_RS08640 (1734046) | 1734046..1734378 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
OLR74_RS08645 (1734815) | 1734815..1734964 | - | 150 | WP_011443592.1 | protein YdfW | - |
OLR74_RS08650 (1734999) | 1734999..1735277 | - | 279 | Protein_1692 | protein YdfX | - |
OLR74_RS08655 (1735261) | 1735261..1735491 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
OLR74_RS08660 (1735575) | 1735575..1735982 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
OLR74_RS08665 (1736149) | 1736149..1736304 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
OLR74_RS08670 (1736306) | 1736306..1736434 | + | 129 | WP_000344964.1 | protein YdfB | - |
OLR74_RS08675 (1736464) | 1736464..1736682 | + | 219 | WP_001171942.1 | protein YdfC | - |
OLR74_RS08680 (1737250) | 1737250..1737438 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
OLR74_RS08685 (1737435) | 1737435..1737626 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
OLR74_RS08690 (1737719) | 1737719..1738486 | + | 768 | Protein_1700 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1718643..1753440 | 34797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262693 WP_000323025.1 NZ_CP110016:c1733274-1732987 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|