Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1639603..1640129 | Replicon | chromosome |
Accession | NZ_CP064678 | ||
Organism | Escherichia coli K-12 strain CETR3G40 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | IVL03_RS08025 | Protein ID | WP_000323025.1 |
Coordinates | 1639603..1639890 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | IVL03_RS08030 | Protein ID | WP_000534858.1 |
Coordinates | 1639890..1640129 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IVL03_RS07980 | 1634627..1634842 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
IVL03_RS07985 | 1635596..1635811 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
IVL03_RS07990 | 1636112..1636324 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
IVL03_RS07995 | 1636379..1636468 | + | 90 | WP_120795389.1 | hypothetical protein | - |
IVL03_RS08000 | 1636746..1637498 | - | 753 | WP_001047135.1 | antitermination protein | - |
IVL03_RS08005 | 1637512..1638561 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
IVL03_RS08010 | 1638563..1638841 | - | 279 | WP_012304870.1 | hypothetical protein | - |
IVL03_RS08015 | 1638908..1639159 | - | 252 | WP_000980994.1 | hypothetical protein | - |
IVL03_RS08020 | 1639376..1639531 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
IVL03_RS08025 | 1639603..1639890 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
IVL03_RS08030 | 1639890..1640129 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
IVL03_RS08035 | 1640154..1640459 | + | 306 | WP_001326990.1 | hypothetical protein | - |
IVL03_RS08040 | 1640662..1640994 | + | 333 | WP_001301033.1 | protein FlxA | - |
IVL03_RS08045 | 1641431..1641580 | - | 150 | WP_011443592.1 | hypothetical protein | - |
IVL03_RS08050 | 1641615..1641893 | - | 279 | Protein_1573 | hypothetical protein | - |
IVL03_RS08055 | 1641877..1642107 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
IVL03_RS08060 | 1642191..1642598 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
IVL03_RS08065 | 1642765..1642920 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
IVL03_RS08070 | 1643080..1643298 | + | 219 | WP_001171942.1 | hypothetical protein | - |
IVL03_RS08075 | 1643866..1644054 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
IVL03_RS08080 | 1644051..1644242 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
IVL03_RS08085 | 1644335..1645102 | + | 768 | Protein_1580 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1625259..1658720 | 33461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T181427 WP_000323025.1 NZ_CP064678:c1639890-1639603 [Escherichia coli K-12]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T181427 NZ_CP085842:c3561092-3560985 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGTATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGTATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT181427 WP_000534858.1 NZ_CP064678:c1640129-1639890 [Escherichia coli K-12]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT181427 NZ_CP085842:3561150-3561206 [Escherichia coli]
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|