Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2237079..2237605 | Replicon | chromosome |
| Accession | NZ_CP097881 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NAG69_RS10825 | Protein ID | WP_000323025.1 |
| Coordinates | 2237318..2237605 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NAG69_RS10820 | Protein ID | WP_000534858.1 |
| Coordinates | 2237079..2237318 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG69_RS10760 (2232106) | 2232106..2232873 | - | 768 | Protein_2100 | exonuclease | - |
| NAG69_RS10765 (2232966) | 2232966..2233157 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
| NAG69_RS10770 (2233154) | 2233154..2233342 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| NAG69_RS10775 (2233910) | 2233910..2234128 | - | 219 | WP_001171942.1 | protein YdfC | - |
| NAG69_RS10780 (2234158) | 2234158..2234286 | - | 129 | WP_000344964.1 | protein YdfB | - |
| NAG69_RS10785 (2234288) | 2234288..2234443 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
| NAG69_RS10790 (2234610) | 2234610..2235017 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| NAG69_RS10795 (2235101) | 2235101..2235331 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| NAG69_RS10800 (2235315) | 2235315..2235593 | + | 279 | Protein_2108 | hypothetical protein | - |
| NAG69_RS10805 (2235628) | 2235628..2235777 | + | 150 | WP_011443592.1 | protein YdfW | - |
| NAG69_RS10810 (2236214) | 2236214..2236546 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
| NAG69_RS10815 (2236749) | 2236749..2237054 | - | 306 | WP_001326990.1 | protein YdfV | - |
| NAG69_RS10820 (2237079) | 2237079..2237318 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NAG69_RS10825 (2237318) | 2237318..2237605 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NAG69_RS10830 (2237677) | 2237677..2237832 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NAG69_RS10835 (2238049) | 2238049..2238300 | + | 252 | WP_000980994.1 | protein Rem | - |
| NAG69_RS10840 (2238367) | 2238367..2238645 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| NAG69_RS10845 (2238647) | 2238647..2239696 | + | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
| NAG69_RS10850 (2239710) | 2239710..2240462 | + | 753 | WP_001047135.1 | antitermination protein | - |
| NAG69_RS10855 (2240740) | 2240740..2240829 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| NAG69_RS10860 (2240884) | 2240884..2241096 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| NAG69_RS10865 (2241397) | 2241397..2241612 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NAG69_RS10870 (2241976) | 2241976..2242146 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| NAG69_RS10875 (2242366) | 2242366..2242581 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2218488..2258846 | 40358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246421 WP_000323025.1 NZ_CP097881:2237318-2237605 [Escherichia coli str. K-12 substr. MG1655]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|