Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1650163..1650689 | Replicon | chromosome |
Accession | NZ_CP054665 | ||
Organism | Escherichia coli strain IGC_EcoliInv_1.1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | HUR94_RS08220 | Protein ID | WP_000323025.1 |
Coordinates | 1650163..1650450 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | HUR94_RS08225 | Protein ID | WP_000534858.1 |
Coordinates | 1650450..1650689 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUR94_RS08170 (1645187) | 1645187..1645402 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
HUR94_RS08175 (1645622) | 1645622..1645792 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
HUR94_RS08180 (1646156) | 1646156..1646371 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
HUR94_RS08185 (1646672) | 1646672..1646884 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
HUR94_RS08190 (1646939) | 1646939..1647028 | + | 90 | WP_120795389.1 | hypothetical protein | - |
HUR94_RS08195 (1647306) | 1647306..1648058 | - | 753 | WP_001047135.1 | antitermination protein | - |
HUR94_RS08200 (1648072) | 1648072..1649121 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
HUR94_RS08205 (1649123) | 1649123..1649401 | - | 279 | WP_012304870.1 | hypothetical protein | - |
HUR94_RS08210 (1649468) | 1649468..1649719 | - | 252 | WP_000980994.1 | protein Rem | - |
HUR94_RS08215 (1649936) | 1649936..1650091 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
HUR94_RS08220 (1650163) | 1650163..1650450 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
HUR94_RS08225 (1650450) | 1650450..1650689 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
HUR94_RS08230 (1650714) | 1650714..1651019 | + | 306 | WP_001326990.1 | protein YdfV | - |
HUR94_RS08235 (1651222) | 1651222..1651554 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
HUR94_RS08240 (1651991) | 1651991..1652140 | - | 150 | WP_011443592.1 | protein YdfW | - |
HUR94_RS08245 (1652175) | 1652175..1652453 | - | 279 | Protein_1605 | hypothetical protein | - |
HUR94_RS08250 (1652437) | 1652437..1652667 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
HUR94_RS08255 (1652751) | 1652751..1653158 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
HUR94_RS08260 (1653325) | 1653325..1653480 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
HUR94_RS22945 (1653482) | 1653482..1653610 | + | 129 | WP_000344964.1 | protein YdfB | - |
HUR94_RS08265 (1653640) | 1653640..1653858 | + | 219 | WP_001171942.1 | protein YdfC | - |
HUR94_RS08270 (1654426) | 1654426..1654614 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
HUR94_RS08275 (1654611) | 1654611..1654802 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
HUR94_RS08280 (1654895) | 1654895..1655662 | + | 768 | Protein_1613 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1635819..1661561 | 25742 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T160046 WP_000323025.1 NZ_CP054665:c1650450-1650163 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T160046 NZ_CP070284:2446782-2446885 [Escherichia albertii]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAAAAC
AGGAATCGTTTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAAAAC
AGGAATCGTTTTCGGTCTCTTTTT
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT160046 WP_000534858.1 NZ_CP054665:c1650689-1650450 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT160046 NZ_CP070284:c2446887-2446655 [Escherichia albertii]
ATAAAAAGAGACCGAAAACGATTCCTGTTTTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTGCGTACAAAATGGTCAG
TAAAAAGCGCGTCGGCCATCGTCTTAAATGTTAAAAACCGCCCGTTCTGGTGAAAGAACTGTGGCGGTTTTTT
ATAAAAAGAGACCGAAAACGATTCCTGTTTTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTGCGTACAAAATGGTCAG
TAAAAAGCGCGTCGGCCATCGTCTTAAATGTTAAAAACCGCCCGTTCTGGTGAAAGAACTGTGGCGGTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|