Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2847576..2848102 | Replicon | chromosome |
Accession | NZ_CP097884 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NAG72_RS13675 | Protein ID | WP_000323025.1 |
Coordinates | 2847815..2848102 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NAG72_RS13670 | Protein ID | WP_000534858.1 |
Coordinates | 2847576..2847815 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG72_RS13610 (2842603) | 2842603..2843370 | - | 768 | Protein_2638 | exonuclease | - |
NAG72_RS13615 (2843463) | 2843463..2843654 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
NAG72_RS13620 (2843651) | 2843651..2843839 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
NAG72_RS13625 (2844407) | 2844407..2844625 | - | 219 | WP_001171942.1 | protein YdfC | - |
NAG72_RS13630 (2844655) | 2844655..2844783 | - | 129 | WP_000344964.1 | protein YdfB | - |
NAG72_RS13635 (2844785) | 2844785..2844940 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
NAG72_RS13640 (2845107) | 2845107..2845514 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
NAG72_RS13645 (2845598) | 2845598..2845828 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
NAG72_RS13650 (2845812) | 2845812..2846090 | + | 279 | Protein_2646 | hypothetical protein | - |
NAG72_RS13655 (2846125) | 2846125..2846274 | + | 150 | WP_011443592.1 | protein YdfW | - |
NAG72_RS13660 (2846711) | 2846711..2847043 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
NAG72_RS13665 (2847246) | 2847246..2847551 | - | 306 | WP_001326990.1 | protein YdfV | - |
NAG72_RS13670 (2847576) | 2847576..2847815 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NAG72_RS13675 (2847815) | 2847815..2848102 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NAG72_RS13680 (2848174) | 2848174..2848329 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
NAG72_RS13685 (2848546) | 2848546..2848797 | + | 252 | WP_000980994.1 | protein Rem | - |
NAG72_RS13690 (2848864) | 2848864..2849142 | + | 279 | WP_012304870.1 | hypothetical protein | - |
NAG72_RS13695 (2849144) | 2849144..2850193 | + | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
NAG72_RS13700 (2850207) | 2850207..2850959 | + | 753 | WP_001047135.1 | antitermination protein | - |
NAG72_RS13705 (2851237) | 2851237..2851326 | - | 90 | WP_120795389.1 | hypothetical protein | - |
NAG72_RS13710 (2851381) | 2851381..2851593 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
NAG72_RS13715 (2851894) | 2851894..2852109 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
NAG72_RS13720 (2852473) | 2852473..2852643 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
NAG72_RS13725 (2852863) | 2852863..2853078 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2828985..2869343 | 40358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246500 WP_000323025.1 NZ_CP097884:2847815-2848102 [Escherichia coli str. K-12 substr. MG1655]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|