Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2222126..2222652 | Replicon | chromosome |
Accession | NZ_CP097883 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NAG71_RS10735 | Protein ID | WP_000323025.1 |
Coordinates | 2222365..2222652 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NAG71_RS10730 | Protein ID | WP_000534858.1 |
Coordinates | 2222126..2222365 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG71_RS10670 (2217153) | 2217153..2217920 | - | 768 | Protein_2082 | exonuclease | - |
NAG71_RS10675 (2218013) | 2218013..2218204 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
NAG71_RS10680 (2218201) | 2218201..2218389 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
NAG71_RS10685 (2218957) | 2218957..2219175 | - | 219 | WP_001171942.1 | protein YdfC | - |
NAG71_RS10690 (2219205) | 2219205..2219333 | - | 129 | WP_000344964.1 | protein YdfB | - |
NAG71_RS10695 (2219335) | 2219335..2219490 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
NAG71_RS10700 (2219657) | 2219657..2220064 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
NAG71_RS10705 (2220148) | 2220148..2220378 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
NAG71_RS10710 (2220362) | 2220362..2220640 | + | 279 | Protein_2090 | hypothetical protein | - |
NAG71_RS10715 (2220675) | 2220675..2220824 | + | 150 | WP_011443592.1 | protein YdfW | - |
NAG71_RS10720 (2221261) | 2221261..2221593 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
NAG71_RS10725 (2221796) | 2221796..2222101 | - | 306 | WP_001326990.1 | protein YdfV | - |
NAG71_RS10730 (2222126) | 2222126..2222365 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NAG71_RS10735 (2222365) | 2222365..2222652 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NAG71_RS10740 (2222724) | 2222724..2222879 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
NAG71_RS10745 (2223096) | 2223096..2223347 | + | 252 | WP_000980994.1 | protein Rem | - |
NAG71_RS10750 (2223414) | 2223414..2223692 | + | 279 | WP_012304870.1 | hypothetical protein | - |
NAG71_RS10755 (2223694) | 2223694..2224743 | + | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
NAG71_RS10760 (2224757) | 2224757..2225509 | + | 753 | WP_001047135.1 | antitermination protein | - |
NAG71_RS10765 (2225787) | 2225787..2225876 | - | 90 | WP_120795389.1 | hypothetical protein | - |
NAG71_RS10770 (2225931) | 2225931..2226143 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
NAG71_RS10775 (2226444) | 2226444..2226659 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
NAG71_RS10780 (2227023) | 2227023..2227193 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
NAG71_RS10785 (2227413) | 2227413..2227628 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2211254..2239646 | 28392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246473 WP_000323025.1 NZ_CP097883:2222365-2222652 [Escherichia coli str. K-12 substr. MG1655]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|