Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1268896..1269422 | Replicon | chromosome |
| Accession | NZ_CP128218 | ||
| Organism | Escherichia coli strain TG1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | QSI84_RS06320 | Protein ID | WP_000323025.1 |
| Coordinates | 1268896..1269183 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | QSI84_RS06325 | Protein ID | WP_000534858.1 |
| Coordinates | 1269183..1269422 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSI84_RS06270 (1263920) | 1263920..1264135 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| QSI84_RS06275 (1264355) | 1264355..1264525 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| QSI84_RS06280 (1264889) | 1264889..1265104 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| QSI84_RS06285 (1265405) | 1265405..1265617 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| QSI84_RS06290 (1265672) | 1265672..1265761 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| QSI84_RS06295 (1266039) | 1266039..1266791 | - | 753 | WP_001047135.1 | antitermination protein | - |
| QSI84_RS06300 (1266805) | 1266805..1267854 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| QSI84_RS06305 (1267856) | 1267856..1268134 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| QSI84_RS06310 (1268201) | 1268201..1268452 | - | 252 | WP_000980994.1 | protein Rem | - |
| QSI84_RS06315 (1268669) | 1268669..1268824 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| QSI84_RS06320 (1268896) | 1268896..1269183 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| QSI84_RS06325 (1269183) | 1269183..1269422 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| QSI84_RS06330 (1269447) | 1269447..1269752 | + | 306 | WP_001326990.1 | protein YdfV | - |
| QSI84_RS06335 (1269955) | 1269955..1270287 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| QSI84_RS06340 (1270724) | 1270724..1270873 | - | 150 | WP_011443592.1 | protein YdfW | - |
| QSI84_RS06345 (1270908) | 1270908..1271186 | - | 279 | Protein_1239 | protein YdfX | - |
| QSI84_RS06350 (1271170) | 1271170..1271400 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| QSI84_RS06355 (1271484) | 1271484..1271891 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| QSI84_RS06360 (1272058) | 1272058..1272213 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
| QSI84_RS06365 (1272215) | 1272215..1272343 | + | 129 | WP_000344964.1 | protein YdfB | - |
| QSI84_RS06370 (1272373) | 1272373..1272591 | + | 219 | WP_001171942.1 | protein YdfC | - |
| QSI84_RS06375 (1273159) | 1273159..1273347 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| QSI84_RS06380 (1273344) | 1273344..1273535 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
| QSI84_RS06385 (1273628) | 1273628..1274395 | + | 768 | Protein_1247 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1253353..1288790 | 35437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T284417 WP_000323025.1 NZ_CP128218:c1269183-1268896 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|