Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
Location | 15231..16324 | Replicon | chromosome |
Accession | NZ_CP046845 | ||
Organism | Vibrio cholerae C6706 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | GPY04_RS14110 | Protein ID | WP_000351248.1 |
Coordinates | 15231..15632 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | GPY04_RS14115 | Protein ID | WP_001047169.1 |
Coordinates | 15632..16324 (-) | Length | 231 a.a. |
Genomic Context
Location: 11863..12135 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 12132..12629 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 16835..17815 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 10525..10812 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 10964..11632 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 12831..12983 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 13305..13760 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 13888..14175 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 14165..14416 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 14630..15043 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 15118..15261 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 15231..15632 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 15632..16324 (693 bp)
Type: Antitoxin
Protein ID: WP_001047169.1
Type: Antitoxin
Protein ID: WP_001047169.1
Location: 16461..16767 (307 bp)
Type: Others
Protein ID: Protein_32
Type: Others
Protein ID: Protein_32
Location: 17940..18095 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 18263..18697 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 18834..19148 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 19135..19467 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 19808..20035 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 19984..20097 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 20263..20544 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 20493..20607 (115 bp)
Type: Others
Protein ID: Protein_41
Type: Others
Protein ID: Protein_41
Location: 20664..21041 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPY04_RS14055 | 10525..10812 | - | 288 | WP_000426470.1 | hypothetical protein | - |
GPY04_RS14060 | 10964..11632 | - | 669 | WP_000043871.1 | hypothetical protein | - |
GPY04_RS14065 | 11863..12135 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GPY04_RS14070 | 12132..12629 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GPY04_RS14080 | 12831..12983 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
GPY04_RS14085 | 13305..13760 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GPY04_RS14090 | 13888..14175 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GPY04_RS14095 | 14165..14416 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GPY04_RS14100 | 14630..15043 | - | 414 | WP_000049417.1 | VOC family protein | - |
GPY04_RS14105 | 15118..15261 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GPY04_RS14110 | 15231..15632 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
GPY04_RS14115 | 15632..16324 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
GPY04_RS14120 | 16461..16767 | - | 307 | Protein_32 | CatB-related O-acetyltransferase | - |
GPY04_RS14125 | 16835..17815 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GPY04_RS14130 | 17940..18095 | - | 156 | WP_000751734.1 | hypothetical protein | - |
GPY04_RS14135 | 18263..18697 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GPY04_RS14140 | 18834..19148 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
GPY04_RS14145 | 19135..19467 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GPY04_RS14155 | 19808..20035 | - | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GPY04_RS14160 | 19984..20097 | - | 114 | WP_001889158.1 | hypothetical protein | - |
GPY04_RS14170 | 20263..20544 | - | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
GPY04_RS19350 | 20493..20607 | - | 115 | Protein_41 | acetyltransferase | - |
GPY04_RS14175 | 20664..21041 | - | 378 | WP_000411109.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | catB9 | hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA | 113..1070288 | 1070175 | |
flank | IS/Tn | - | - | 16835..17815 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T145081 WP_000351248.1 NZ_CP046845:c15632-15231 [Vibrio cholerae C6706]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T145081 NZ_CP062254:c623192-622941 [Pectobacterium parmentieri]
ATGCGTACAATTAGCTACAGCGAAGCCCGCCAAAACCTATCAGCAACCATGATGAAAACGGTCGAAGACCGTGCTCCCAT
TCTTATCACCCGACAGAATGGCGAAGCCTGTGTGCTGATGTCTCTGGAAGAGTATAACTCTCTAGAAGAAACCGCGTATT
TACTGCGTTCTCCCGCCAATGCCAAAAGACTGATGAATGCAATCGAGAGCCTTAAGGCTGGCAATGGCGAAGAAAGAGAT
ATCATTGAGTGA
ATGCGTACAATTAGCTACAGCGAAGCCCGCCAAAACCTATCAGCAACCATGATGAAAACGGTCGAAGACCGTGCTCCCAT
TCTTATCACCCGACAGAATGGCGAAGCCTGTGTGCTGATGTCTCTGGAAGAGTATAACTCTCTAGAAGAAACCGCGTATT
TACTGCGTTCTCCCGCCAATGCCAAAAGACTGATGAATGCAATCGAGAGCCTTAAGGCTGGCAATGGCGAAGAAAGAGAT
ATCATTGAGTGA
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT145081 WP_001047169.1 NZ_CP046845:c16324-15632 [Vibrio cholerae C6706]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
>AT145081 NZ_CP062254:c622944-622690 [Pectobacterium parmentieri]
GTGAAGCCAATCTGGTCAGAAGCAGCATGGGAAGACTACCTGTACTGGCAGGATATCGATAATCGGATAGTCAAAAAAAT
CAATGAATTAATAAAAGAAATTCGCAGAACGCCTTTTGAGGGAAAAGGAAAACCAGAGCCGCTTAAACATAATCTTGCTG
GCTTCTGGTCACGCCGTATCACCGAAGAACATCGTCTGGTCTATGCCATCACCGATGACGCCATGATGATCGCTGCCTGC
CGCTACCACTATTAA
GTGAAGCCAATCTGGTCAGAAGCAGCATGGGAAGACTACCTGTACTGGCAGGATATCGATAATCGGATAGTCAAAAAAAT
CAATGAATTAATAAAAGAAATTCGCAGAACGCCTTTTGAGGGAAAAGGAAAACCAGAGCCGCTTAAACATAATCTTGCTG
GCTTCTGGTCACGCCGTATCACCGAAGAACATCGTCTGGTCTATGCCATCACCGATGACGCCATGATGATCGCTGCCTGC
CGCTACCACTATTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |