Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 415424..416057 | Replicon | chromosome |
Accession | NZ_CP013320 | ||
Organism | Vibrio cholerae strain NCTC9420 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q9KMA6 |
Locus tag | ASZ86_RS16635 | Protein ID | WP_000843587.1 |
Coordinates | 415424..415756 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ASZ86_RS16640 | Protein ID | WP_000071008.1 |
Coordinates | 415743..416057 (+) | Length | 105 a.a. |
Genomic Context
Location: 410865..411068 (204 bp)
Type: Others
Protein ID: WP_001911745.1
Type: Others
Protein ID: WP_001911745.1
Location: 411349..411522 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Location: 411882..412151 (270 bp)
Type: Others
Protein ID: WP_001198131.1
Type: Others
Protein ID: WP_001198131.1
Location: 412469..412640 (172 bp)
Type: Others
Protein ID: Protein_434
Type: Others
Protein ID: Protein_434
Location: 412849..413235 (387 bp)
Type: Others
Protein ID: WP_000703163.1
Type: Others
Protein ID: WP_000703163.1
Location: 413437..413679 (243 bp)
Type: Others
Protein ID: WP_000107461.1
Type: Others
Protein ID: WP_000107461.1
Location: 413850..414227 (378 bp)
Type: Others
Protein ID: WP_071919850.1
Type: Others
Protein ID: WP_071919850.1
Location: 414284..414398 (115 bp)
Type: Others
Protein ID: Protein_438
Type: Others
Protein ID: Protein_438
Location: 414347..414628 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 414794..414907 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 414856..415083 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 415424..415756 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1
Type: Toxin
Protein ID: WP_000843587.1
Location: 415743..416057 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1
Type: Antitoxin
Protein ID: WP_000071008.1
Location: 416194..416628 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 416796..416951 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 418124..418430 (307 bp)
Type: Others
Protein ID: Protein_447
Type: Others
Protein ID: Protein_447
Location: 418567..419259 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 419259..419660 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 419630..419773 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 419848..420261 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 420475..420726 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 420716..421003 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 417076..418056 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASZ86_RS20720 | 410865..411068 | + | 204 | WP_001911745.1 | hypothetical protein | - |
ASZ86_RS20530 | 411349..411522 | + | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
ASZ86_RS16575 | 411882..412151 | + | 270 | WP_001198131.1 | hypothetical protein | - |
ASZ86_RS20835 | 412469..412640 | + | 172 | Protein_434 | DUF645 family protein | - |
ASZ86_RS16590 | 412849..413235 | + | 387 | WP_000703163.1 | VOC family protein | - |
ASZ86_RS16595 | 413437..413679 | + | 243 | WP_000107461.1 | hypothetical protein | - |
ASZ86_RS16600 | 413850..414227 | + | 378 | WP_071919850.1 | hypothetical protein | - |
ASZ86_RS20810 | 414284..414398 | + | 115 | Protein_438 | acetyltransferase | - |
ASZ86_RS16605 | 414347..414628 | + | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
ASZ86_RS16620 | 414794..414907 | + | 114 | WP_001889158.1 | hypothetical protein | - |
ASZ86_RS16625 | 414856..415083 | + | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
ASZ86_RS16635 | 415424..415756 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ASZ86_RS16640 | 415743..416057 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | Antitoxin |
ASZ86_RS16645 | 416194..416628 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
ASZ86_RS20650 | 416796..416951 | + | 156 | WP_000751734.1 | hypothetical protein | - |
ASZ86_RS16660 | 417076..418056 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
ASZ86_RS16665 | 418124..418430 | + | 307 | Protein_447 | CatB-related O-acetyltransferase | - |
ASZ86_RS16670 | 418567..419259 | + | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
ASZ86_RS16675 | 419259..419660 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
ASZ86_RS20545 | 419630..419773 | + | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
ASZ86_RS16685 | 419848..420261 | + | 414 | WP_000049417.1 | VOC family protein | - |
ASZ86_RS16690 | 420475..420726 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ASZ86_RS16695 | 420716..421003 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 304702..436238 | 131536 | |
- | inside | Integron | - | - | 309782..435862 | 126080 | |
flank | IS/Tn | - | - | 417076..418056 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13005.95 Da Isoelectric Point: 9.9244
>T58424 WP_000843587.1 NZ_CP013320:415424-415756 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS
Download Length: 333 bp
>T58424 NZ_CP013320:415424-415756 [Vibrio cholerae]
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
ATGAAAAGTGTATTTGTCGAATCAACAATTTTTGAAAAGTACCGAGATGAATATCTCAGTGATGAGGAGTATAGGCTCTT
TCAAGCAGAGCTAATGCTAAACCCCAAGCTGGGTGATGTGATTCAAGGTACTGGCGGTTTGCGAAAAATTCGAGTTGCGA
GTAAAGGCAAGGGAAAGCGTGGTGGTTCACGGATTATCTATTACTTTCTCGATGAAAAGAGGCGTTTCTATTTGCTAACC
ATTTACGGCAAAAATGAAATGTCTGACTTGAATGCAAATCAAAGGAAACAACTAATGGCTTTTATGGAGGCGTGGCGCAA
TGAGCAATCGTGA
Antitoxin
Download Length: 105 a.a. Molecular weight: 11696.20 Da Isoelectric Point: 6.7600
>AT58424 WP_000071008.1 NZ_CP013320:415743-416057 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL
Download Length: 315 bp
>AT58424 NZ_CP013320:415743-416057 [Vibrio cholerae]
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA
ATGAGCAATCGTGATTTATTTGCAGAGTTAAGCTCAGCTCTTGTTGAGGCTAAGCAGCATTCAGAAGGTAAGCTTACTCT
GAAAACACATCATGTGAATGATGTGGGTGAGTTGAACATCTCACCGGATGAAATCGTGAGTATTCGCGAGCAGTTCAATA
TGTCCCGCGGAGTCTTCGCGCGGTTACTTCATACGTCTTCGCGCACATTAGAAAACTGGGAACAAGGTCGTAGTGTGCCA
AATGGTCAAGCGGTCACTCTTTTAAAGTTAGTACAGCGTCATCCAGAAACGTTGTCACACATAGCCGAGCTATAA