Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 417492..418020 | Replicon | chromosome |
Accession | NZ_CP047306 | ||
Organism | Vibrio cholerae O37 strain ATCC 25872 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | GTH07_RS15565 | Protein ID | WP_000221354.1 |
Coordinates | 417733..418020 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | GTH07_RS15560 | Protein ID | WP_001250179.1 |
Coordinates | 417492..417743 (+) | Length | 84 a.a. |
Genomic Context
Location: 412761..413075 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 413212..413646 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 413814..413969 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 415142..415448 (307 bp)
Type: Others
Protein ID: Protein_455
Type: Others
Protein ID: Protein_455
Location: 415585..415983 (399 bp)
Type: Others
Protein ID: Protein_456
Type: Others
Protein ID: Protein_456
Location: 416107..416277 (171 bp)
Type: Others
Protein ID: WP_001080654.1
Type: Others
Protein ID: WP_001080654.1
Location: 416277..416678 (402 bp)
Type: Others
Protein ID: WP_000351251.1
Type: Others
Protein ID: WP_000351251.1
Location: 416648..416790 (143 bp)
Type: Others
Protein ID: Protein_459
Type: Others
Protein ID: Protein_459
Location: 416865..417278 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 417492..417743 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 417733..418020 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 418148..418603 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 418660..418782 (123 bp)
Type: Others
Protein ID: Protein_464
Type: Others
Protein ID: Protein_464
Location: 418953..419077 (125 bp)
Type: Others
Protein ID: Protein_465
Type: Others
Protein ID: Protein_465
Location: 420198..420260 (63 bp)
Type: Others
Protein ID: Protein_468
Type: Others
Protein ID: Protein_468
Location: 420277..420945 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 421097..421384 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 421525..421896 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 422119..422388 (270 bp)
Type: Others
Protein ID: WP_000179600.1
Type: Others
Protein ID: WP_000179600.1
Location: 422385..422918 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 414094..415074 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 419280..419777 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 419774..420046 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTH07_RS15520 (GTH07_15595) | 412761..413075 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
GTH07_RS15525 (GTH07_15600) | 413212..413646 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GTH07_RS15530 (GTH07_15605) | 413814..413969 | + | 156 | WP_000751734.1 | hypothetical protein | - |
GTH07_RS15535 (GTH07_15610) | 414094..415074 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GTH07_RS15540 (GTH07_15615) | 415142..415448 | + | 307 | Protein_455 | CatB-related O-acetyltransferase | - |
GTH07_RS18715 | 415585..415983 | + | 399 | Protein_456 | GNAT family N-acetyltransferase | - |
GTH07_RS18720 | 416107..416277 | + | 171 | WP_001080654.1 | hypothetical protein | - |
GTH07_RS15550 (GTH07_15625) | 416277..416678 | + | 402 | WP_000351251.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GTH07_RS18725 | 416648..416790 | + | 143 | Protein_459 | DUF3265 domain-containing protein | - |
GTH07_RS15555 (GTH07_15630) | 416865..417278 | + | 414 | WP_000049417.1 | VOC family protein | - |
GTH07_RS15560 (GTH07_15635) | 417492..417743 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GTH07_RS15565 (GTH07_15640) | 417733..418020 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTH07_RS15570 (GTH07_15645) | 418148..418603 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GTH07_RS18730 | 418660..418782 | + | 123 | Protein_464 | acetyltransferase | - |
GTH07_RS15575 (GTH07_15650) | 418953..419077 | + | 125 | Protein_465 | DUF645 family protein | - |
GTH07_RS15580 (GTH07_15655) | 419280..419777 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GTH07_RS15585 (GTH07_15660) | 419774..420046 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GTH07_RS18735 | 420198..420260 | + | 63 | Protein_468 | acetyltransferase | - |
GTH07_RS15590 (GTH07_15665) | 420277..420945 | + | 669 | WP_000043871.1 | hypothetical protein | - |
GTH07_RS15595 (GTH07_15670) | 421097..421384 | + | 288 | WP_000426470.1 | hypothetical protein | - |
GTH07_RS15600 (GTH07_15675) | 421525..421896 | + | 372 | WP_001164080.1 | MazG nucleotide pyrophosphohydrolase domain-containing protein | - |
GTH07_RS18740 (GTH07_15680) | 422119..422388 | + | 270 | WP_000179600.1 | DUF1778 domain-containing protein | - |
GTH07_RS15610 (GTH07_15685) | 422385..422918 | + | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 307620..433724 | 126104 | |
- | inside | Integron | - | - | 312700..433348 | 120648 | |
flank | IS/Tn | - | - | 414094..415074 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T145913 WP_000221354.1 NZ_CP047306:417733-418020 [Vibrio cholerae O37]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T145913 NZ_CP062708:c4475591-4475193 [Escherichia coli O157:H7]
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAGCTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTGTTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACTTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAATCGCATTTGGTATATTGTCAGGGTGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAACCTGA
ACCTCATAAACTGGCTCGAGATAACAACCAAATGCATAAAATTGGGAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAGCTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTGTTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACTTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAATCGCATTTGGTATATTGTCAGGGTGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAACCTGA
ACCTCATAAACTGGCTCGAGATAACAACCAAATGCATAAAATTGGGAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT145913 WP_001250179.1 NZ_CP047306:417492-417743 [Vibrio cholerae O37]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT145913 NZ_CP062708:c4475887-4475594 [Escherichia coli O157:H7]
ATGCATCGAATTCTCGCTGAAAAATCGGTCAATATCACTGAATTACGTAAAAACCCAGCTAAATACTTTATTGATCAACC
GGTTGCGGTTCTTTCTAATAATCGCCCCGCAGGATATCTCTTAAGTGCCAGCGCATTCGAAGCGTTAATGGACATGCTTG
CTGAACAAGAGGAGAAAAAGCCCATAAAGGCGCGCTTCCGTCCAAGTGCTGCAAGATTAGAGGAAATTACACGCCGAGCT
GAAAAATATCTTAATGATATGACGGATGATGATTTCAATGACTTTAAGGAATAA
ATGCATCGAATTCTCGCTGAAAAATCGGTCAATATCACTGAATTACGTAAAAACCCAGCTAAATACTTTATTGATCAACC
GGTTGCGGTTCTTTCTAATAATCGCCCCGCAGGATATCTCTTAAGTGCCAGCGCATTCGAAGCGTTAATGGACATGCTTG
CTGAACAAGAGGAGAAAAAGCCCATAAAGGCGCGCTTCCGTCCAAGTGCTGCAAGATTAGAGGAAATTACACGCCGAGCT
GAAAAATATCTTAATGATATGACGGATGATGATTTCAATGACTTTAAGGAATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |