Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 70964..71535 | Replicon | chromosome |
Accession | NZ_AP024556 | ||
Organism | Vibrio cholerae strain IDH-03506 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | K6J79_RS14410 | Protein ID | WP_000351248.1 |
Coordinates | 71134..71535 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | Q8GNG3 |
Locus tag | K6J79_RS19005 | Protein ID | WP_001080654.1 |
Coordinates | 70964..71134 (+) | Length | 57 a.a. |
Genomic Context
Location: 66159..66273 (115 bp)
Type: Others
Protein ID: Protein_134
Type: Others
Protein ID: Protein_134
Location: 66282..66503 (222 bp)
Type: Others
Protein ID: WP_032468461.1
Type: Others
Protein ID: WP_032468461.1
Location: 66669..66782 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 66731..66958 (228 bp)
Type: Others
Protein ID: WP_073426587.1
Type: Others
Protein ID: WP_073426587.1
Location: 67299..67631 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 67618..67932 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 68069..68503 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 68671..68826 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 69999..70305 (307 bp)
Type: Others
Protein ID: Protein_143
Type: Others
Protein ID: Protein_143
Location: 70442..70840 (399 bp)
Type: Others
Protein ID: Protein_144
Type: Others
Protein ID: Protein_144
Location: 70964..71134 (171 bp)
Type: Antitoxin
Protein ID: WP_001080654.1
Type: Antitoxin
Protein ID: WP_001080654.1
Location: 71134..71535 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 71538..71648 (111 bp)
Type: Others
Protein ID: WP_082798255.1
Type: Others
Protein ID: WP_082798255.1
Location: 71723..72136 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 72350..72601 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 72591..72878 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 73006..73461 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 73518..73640 (123 bp)
Type: Others
Protein ID: Protein_152
Type: Others
Protein ID: Protein_152
Location: 73811..73935 (125 bp)
Type: Others
Protein ID: Protein_153
Type: Others
Protein ID: Protein_153
Location: 74052..74120 (69 bp)
Type: Others
Protein ID: Protein_154
Type: Others
Protein ID: Protein_154
Location: 75054..75116 (63 bp)
Type: Others
Protein ID: Protein_157
Type: Others
Protein ID: Protein_157
Location: 75133..75801 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 75953..76240 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 68951..69931 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 74137..74633 (497 bp)
Type: Others
Protein ID: Protein_155
Type: Others
Protein ID: Protein_155
Location: 74630..74902 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6J79_RS14355 | 66159..66273 | + | 115 | Protein_134 | acetyltransferase | - |
K6J79_RS14360 | 66282..66503 | + | 222 | WP_032468461.1 | DUF1289 domain-containing protein | - |
K6J79_RS14365 | 66669..66782 | + | 114 | WP_001889158.1 | hypothetical protein | - |
K6J79_RS14370 | 66731..66958 | + | 228 | WP_073426587.1 | DUF1289 domain-containing protein | - |
K6J79_RS14375 | 67299..67631 | + | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K6J79_RS14380 | 67618..67932 | + | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
K6J79_RS14385 | 68069..68503 | + | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
K6J79_RS14390 | 68671..68826 | + | 156 | WP_000751734.1 | hypothetical protein | - |
K6J79_RS14395 | 68951..69931 | - | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
K6J79_RS14400 | 69999..70305 | + | 307 | Protein_143 | CatB-related O-acetyltransferase | - |
K6J79_RS19000 | 70442..70840 | + | 399 | Protein_144 | GNAT family N-acetyltransferase | - |
K6J79_RS19005 | 70964..71134 | + | 171 | WP_001080654.1 | hypothetical protein | Antitoxin |
K6J79_RS14410 | 71134..71535 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
K6J79_RS19010 | 71538..71648 | + | 111 | WP_082798255.1 | DUF3265 domain-containing protein | - |
K6J79_RS14415 | 71723..72136 | + | 414 | WP_000049417.1 | VOC family protein | - |
K6J79_RS14420 | 72350..72601 | + | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
K6J79_RS14425 | 72591..72878 | + | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
K6J79_RS14430 | 73006..73461 | + | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
K6J79_RS19015 | 73518..73640 | + | 123 | Protein_152 | acetyltransferase | - |
K6J79_RS14435 | 73811..73935 | + | 125 | Protein_153 | DUF645 family protein | - |
K6J79_RS19020 | 74052..74120 | + | 69 | Protein_154 | acetyltransferase | - |
K6J79_RS14440 | 74137..74633 | - | 497 | Protein_155 | GNAT family N-acetyltransferase | - |
K6J79_RS14445 | 74630..74902 | - | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
K6J79_RS19025 | 75054..75116 | + | 63 | Protein_157 | acetyltransferase | - |
K6J79_RS14450 | 75133..75801 | + | 669 | WP_000043871.1 | hypothetical protein | - |
K6J79_RS14455 | 75953..76240 | + | 288 | WP_000426470.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | cqsA / ugd / htpB / hlyA / hcp-2 / vgrG-2 / vipA/mglA / vipB/mglB / VCA0109 / vasA / vasB / vasC / vasD / vasE / vasF / clpB/vasG / vasH / vasI / vasJ / icmF/vasK / vasL / vgrG-3 / hlyA | 3..1061958 | 1061955 | |
flank | IS/Tn | - | - | 68951..69931 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T38696 WP_000351248.1 NZ_AP024556:71134-71535 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T38696 NZ_AP024556:71134-71535 [Vibrio cholerae]
ATGGATATCATCTGTTTTCCTTTTGAACGAGTGATCGAGATTAATGCTTTCATCCTAAAAACAGAACCAGGAATGAAAGG
AGCCGTTGATATTCCCAAGCTTCAGGGGGCATTAGGTCGAATCGATAATGCCATCGTTTATGAAGGACTGGATGATGTTT
TTGAAATCGCTGCTAAATACACTGCTTGTATAGCGGTTTCACATGCGCTACCTGATGCGAACAAACGCACAGGTTTGGCT
GTGGCACTTGAATATTTATCACTTAACGATTTTGAGCTTACGCAGGAAAACGATTTACTTGCGGATGCAGTTCGAGATCT
TGTTATCGGCATTATCAACGAAACAGATTTTGCCGACATTCTCTACGCACAATACGCAAAAGAACAAAATTCAGCTCTCT
AA
ATGGATATCATCTGTTTTCCTTTTGAACGAGTGATCGAGATTAATGCTTTCATCCTAAAAACAGAACCAGGAATGAAAGG
AGCCGTTGATATTCCCAAGCTTCAGGGGGCATTAGGTCGAATCGATAATGCCATCGTTTATGAAGGACTGGATGATGTTT
TTGAAATCGCTGCTAAATACACTGCTTGTATAGCGGTTTCACATGCGCTACCTGATGCGAACAAACGCACAGGTTTGGCT
GTGGCACTTGAATATTTATCACTTAACGATTTTGAGCTTACGCAGGAAAACGATTTACTTGCGGATGCAGTTCGAGATCT
TGTTATCGGCATTATCAACGAAACAGATTTTGCCGACATTCTCTACGCACAATACGCAAAAGAACAAAATTCAGCTCTCT
AA
Antitoxin
Download Length: 57 a.a. Molecular weight: 6287.35 Da Isoelectric Point: 10.7274
>AT38696 WP_001080654.1 NZ_AP024556:70964-71134 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 171 bp
>AT38696 NZ_AP024556:70964-71134 [Vibrio cholerae]
ATGAATCGAAAAGTTGAAGCTTACGGCGTTGATGCTGTTGAAAGACCGAAAATTAAGGCTAGTAAAAAGCTTGATTTGAC
TGGTGATGCTGGTCGTCAAATTGTGAAGTCTGAAACTAAACTTGCTTTGCGTACTCATCAGAAGACATTCACTAAATTGG
CTGATATGTAA
ATGAATCGAAAAGTTGAAGCTTACGGCGTTGATGCTGTTGAAAGACCGAAAATTAAGGCTAGTAAAAAGCTTGATTTGAC
TGGTGATGCTGGTCGTCAAATTGTGAAGTCTGAAACTAAACTTGCTTTGCGTACTCATCAGAAGACATTCACTAAATTGG
CTGATATGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SJJ1 |