Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 846939..847467 | Replicon | chromosome |
Accession | NZ_CP042300 | ||
Organism | Vibrio cholerae O1 strain AAS91 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0X1KZS6 |
Locus tag | FKV26_RS17220 | Protein ID | WP_000221354.1 |
Coordinates | 846939..847226 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0X1KZS8 |
Locus tag | FKV26_RS17225 | Protein ID | WP_001250179.1 |
Coordinates | 847216..847467 (-) | Length | 84 a.a. |
Genomic Context
Location: 844913..845185 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 845182..845679 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 849886..850866 (981 bp)
Type: Others
Protein ID: WP_000019368.1
Type: Others
Protein ID: WP_000019368.1
Location: 842286..842588 (303 bp)
Type: Others
Protein ID: WP_000229325.1
Type: Others
Protein ID: WP_000229325.1
Location: 842576..842833 (258 bp)
Type: Others
Protein ID: WP_070961997.1
Type: Others
Protein ID: WP_070961997.1
Location: 843306..844286 (981 bp)
Type: Others
Protein ID: WP_000019368.1
Type: Others
Protein ID: WP_000019368.1
Location: 844356..844682 (327 bp)
Type: Others
Protein ID: Protein_745
Type: Others
Protein ID: Protein_745
Location: 845882..846034 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 846356..846811 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 846939..847226 (288 bp)
Type: Toxin
Protein ID: WP_000221354.1
Type: Toxin
Protein ID: WP_000221354.1
Location: 847216..847467 (252 bp)
Type: Antitoxin
Protein ID: WP_001250179.1
Type: Antitoxin
Protein ID: WP_001250179.1
Location: 847681..848094 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 848169..848312 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 848282..848683 (402 bp)
Type: Others
Protein ID: WP_000351248.1
Type: Others
Protein ID: WP_000351248.1
Location: 848683..849375 (693 bp)
Type: Others
Protein ID: WP_001047169.1
Type: Others
Protein ID: WP_001047169.1
Location: 849512..849818 (307 bp)
Type: Others
Protein ID: Protein_756
Type: Others
Protein ID: Protein_756
Location: 850991..851191 (201 bp)
Type: Others
Protein ID: WP_001198130.1
Type: Others
Protein ID: WP_001198130.1
Location: 851551..851724 (174 bp)
Type: Others
Protein ID: WP_001882305.1
Type: Others
Protein ID: WP_001882305.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FKV26_RS17175 | 842286..842588 | - | 303 | WP_000229325.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FKV26_RS17180 | 842576..842833 | - | 258 | WP_070961997.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FKV26_RS17190 | 843306..844286 | - | 981 | WP_000019368.1 | IS5-like element ISVch5 family transposase | - |
FKV26_RS17195 | 844356..844682 | - | 327 | Protein_745 | hypothetical protein | - |
FKV26_RS17200 | 844913..845185 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
FKV26_RS17205 | 845182..845679 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
FKV26_RS17210 | 845882..846034 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
FKV26_RS17215 | 846356..846811 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
FKV26_RS17220 | 846939..847226 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FKV26_RS17225 | 847216..847467 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
FKV26_RS17230 | 847681..848094 | - | 414 | WP_000049417.1 | VOC family protein | - |
FKV26_RS17235 | 848169..848312 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
FKV26_RS17240 | 848282..848683 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
FKV26_RS17245 | 848683..849375 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | - |
FKV26_RS17250 | 849512..849818 | - | 307 | Protein_756 | CatB-related O-acetyltransferase | - |
FKV26_RS17255 | 849886..850866 | + | 981 | WP_000019368.1 | IS5-like element ISVch5 family transposase | - |
FKV26_RS18965 | 850991..851191 | - | 201 | WP_001198130.1 | hypothetical protein | - |
FKV26_RS17260 | 851551..851724 | - | 174 | WP_001882305.1 | DUF3709 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | catB9 | - | 827249..947639 | 120390 | |
flank | IS/Tn | - | - | 843306..844286 | 980 | ||
flank | IS/Tn | - | - | 849886..850866 | 980 | ||
- | inside | Integron | - | - | 828494..941258 | 112764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10991.96 Da Isoelectric Point: 10.4934
>T135199 WP_000221354.1 NZ_CP042300:c847226-846939 [Vibrio cholerae O1]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG
Download Length: 288 bp
>T135199 NZ_CP042300:c847226-846939 [Vibrio cholerae O1]
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
ATGACCTATAAGTTAAAGTTTCTGCCGGCTGCGCAAAAGGAATGGAGTAAGTTAGCTCCGACAATTCAGAGTCAGTTCAA
GAAGAAGTTAAAGGAACGATTAGAAAATCCGCACGTCCCTTCGGCTAAGCTTCGAGGATACGACGCTGTTTACAAGATTA
AACTTCGTACGGCGGGTTATCGTTTAGCTTATGAGGTTATTGACGATGAGATAGTTGTCTATGTCCTTGCTGTCGGTAAA
CGTGACAAAGATGCTGTCTATAAAAAACTGGCTTCACGCTTCGGTTAG
Antitoxin
Download Length: 84 a.a. Molecular weight: 9136.29 Da Isoelectric Point: 4.0197
>AT135199 WP_001250179.1 NZ_CP042300:c847467-847216 [Vibrio cholerae O1]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL
Download Length: 252 bp
>AT135199 NZ_CP042300:c847467-847216 [Vibrio cholerae O1]
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
ATGAGACAAGTTTTAGCGAATTGCTCTGCAAGTATTTCAGAGTTAAAGAAGAACCCAACAGCTTTGTTGAATGAGGCTGA
TGGGTCTGCAATTGCAATTTTAAACCACAACAAGCCAGCGGCTTACCTTGTGCCAGCGGAAACGTATGAGTATCTCATCG
ATATGCTCGATGATTATGAGCTTTCCCAAATTGTCGATAGTCGCCGAGCTGACTTAGCACAAGCTGTGGAAGTAAATATT
GATGACCTATAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0X1KZS8 |