Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-GNAT |
Location | 589057..590150 | Replicon | chromosome |
Accession | NZ_CP046743 | ||
Organism | Vibrio cholerae strain 3569-08 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | GPW72_RS02720 | Protein ID | WP_000351248.1 |
Coordinates | 589057..589458 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | GPW72_RS02725 | Protein ID | WP_001047169.1 |
Coordinates | 589458..590150 (-) | Length | 231 a.a. |
Genomic Context
Location: 585689..585961 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 585958..586455 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 590661..591641 (981 bp)
Type: Others
Protein ID: WP_000019370.1
Type: Others
Protein ID: WP_000019370.1
Location: 584351..584638 (288 bp)
Type: Others
Protein ID: WP_000426470.1
Type: Others
Protein ID: WP_000426470.1
Location: 584790..585458 (669 bp)
Type: Others
Protein ID: WP_000043871.1
Type: Others
Protein ID: WP_000043871.1
Location: 586657..586809 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 587131..587586 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 587714..588001 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 587991..588242 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Location: 588456..588869 (414 bp)
Type: Others
Protein ID: WP_000049417.1
Type: Others
Protein ID: WP_000049417.1
Location: 588944..589087 (144 bp)
Type: Others
Protein ID: WP_071908341.1
Type: Others
Protein ID: WP_071908341.1
Location: 589057..589458 (402 bp)
Type: Toxin
Protein ID: WP_000351248.1
Type: Toxin
Protein ID: WP_000351248.1
Location: 589458..590150 (693 bp)
Type: Antitoxin
Protein ID: WP_001047169.1
Type: Antitoxin
Protein ID: WP_001047169.1
Location: 590287..590593 (307 bp)
Type: Others
Protein ID: Protein_526
Type: Others
Protein ID: Protein_526
Location: 591766..591921 (156 bp)
Type: Others
Protein ID: WP_000751734.1
Type: Others
Protein ID: WP_000751734.1
Location: 592089..592523 (435 bp)
Type: Others
Protein ID: WP_000256036.1
Type: Others
Protein ID: WP_000256036.1
Location: 592660..592974 (315 bp)
Type: Others
Protein ID: WP_000071008.1
Type: Others
Protein ID: WP_000071008.1
Location: 592961..593293 (333 bp)
Type: Others
Protein ID: WP_000843587.1
Type: Others
Protein ID: WP_000843587.1
Location: 593634..593861 (228 bp)
Type: Others
Protein ID: WP_001894457.1
Type: Others
Protein ID: WP_001894457.1
Location: 593810..593923 (114 bp)
Type: Others
Protein ID: WP_001889158.1
Type: Others
Protein ID: WP_001889158.1
Location: 594089..594370 (282 bp)
Type: Others
Protein ID: WP_001894453.1
Type: Others
Protein ID: WP_001894453.1
Location: 594319..594433 (115 bp)
Type: Others
Protein ID: Protein_535
Type: Others
Protein ID: Protein_535
Location: 594490..594867 (378 bp)
Type: Others
Protein ID: WP_000411109.1
Type: Others
Protein ID: WP_000411109.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPW72_RS02665 | 584351..584638 | - | 288 | WP_000426470.1 | hypothetical protein | - |
GPW72_RS02670 | 584790..585458 | - | 669 | WP_000043871.1 | hypothetical protein | - |
GPW72_RS02675 | 585689..585961 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
GPW72_RS02680 | 585958..586455 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
GPW72_RS02690 | 586657..586809 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
GPW72_RS02695 | 587131..587586 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
GPW72_RS02700 | 587714..588001 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GPW72_RS02705 | 587991..588242 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GPW72_RS02710 | 588456..588869 | - | 414 | WP_000049417.1 | VOC family protein | - |
GPW72_RS02715 | 588944..589087 | - | 144 | WP_071908341.1 | DUF3265 domain-containing protein | - |
GPW72_RS02720 | 589057..589458 | - | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
GPW72_RS02725 | 589458..590150 | - | 693 | WP_001047169.1 | GNAT family N-acetyltransferase | Antitoxin |
GPW72_RS02730 | 590287..590593 | - | 307 | Protein_526 | CatB-related O-acetyltransferase | - |
GPW72_RS02735 | 590661..591641 | + | 981 | WP_000019370.1 | IS5-like element ISVch5 family transposase | - |
GPW72_RS02740 | 591766..591921 | - | 156 | WP_000751734.1 | hypothetical protein | - |
GPW72_RS02745 | 592089..592523 | - | 435 | WP_000256036.1 | GNAT family N-acetyltransferase | - |
GPW72_RS02750 | 592660..592974 | - | 315 | WP_000071008.1 | DNA-binding transcriptional regulator | - |
GPW72_RS02755 | 592961..593293 | - | 333 | WP_000843587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GPW72_RS02765 | 593634..593861 | - | 228 | WP_001894457.1 | DUF1289 domain-containing protein | - |
GPW72_RS02770 | 593810..593923 | - | 114 | WP_001889158.1 | hypothetical protein | - |
GPW72_RS02780 | 594089..594370 | - | 282 | WP_001894453.1 | DUF1289 domain-containing protein | - |
GPW72_RS19175 | 594319..594433 | - | 115 | Protein_535 | acetyltransferase | - |
GPW72_RS02785 | 594490..594867 | - | 378 | WP_000411109.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 575627..724145 | 148518 | |
- | inside | Integron | - | - | 575627..717201 | 141574 | |
flank | IS/Tn | - | - | 590661..591641 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T144873 WP_000351248.1 NZ_CP046743:c589458-589057 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T144873 NZ_CP062244:c2083194-2082943 [Escherichia coli]
ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTTATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGCTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGAC
ATCATTGAGTGA
ATGCGTACAATTAGCTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTTATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGCTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGAC
ATCATTGAGTGA
Antitoxin
Download Length: 231 a.a. Molecular weight: 26352.73 Da Isoelectric Point: 8.5633
>AT144873 WP_001047169.1 NZ_CP046743:c590150-589458 [Vibrio cholerae]
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNLEEFQESDFDLLIKWIDSDELNYLWGCPAYVFPLTYEQIHSHCSKAEVFPYLLKVKGRHAGFVELYKVTDEQYRICRV
FISNAYRGQGLSKSMLMLLIDKARLDFSATKLSLGVFEQNTVARKCYESLGFEVVMVVVIEFGGMRCQPLRRALCFLSRF
GAIIGLTFIDSRCDMNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 693 bp
>AT144873 NZ_CP062244:c2082946-2082692 [Escherichia coli]
GTGAAACTAATCTGGTCTGAGGAATCATGGGACGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
GTGAAACTAATCTGGTCTGAGGAATCATGGGACGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |