Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 843491..844038 | Replicon | chromosome |
Accession | NZ_CP013013 | ||
Organism | Vibrio cholerae strain Env-390 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | AP033_RS03825 | Protein ID | WP_000229325.1 |
Coordinates | 843491..843793 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | AP033_RS03830 | Protein ID | WP_070961997.1 |
Coordinates | 843781..844038 (-) | Length | 86 a.a. |
Genomic Context
Location: 846118..846390 (273 bp)
Type: Others
Protein ID: WP_000246253.1
Type: Others
Protein ID: WP_000246253.1
Location: 846387..846884 (498 bp)
Type: Others
Protein ID: WP_000982260.1
Type: Others
Protein ID: WP_000982260.1
Location: 839380..839682 (303 bp)
Type: Others
Protein ID: WP_000229317.1
Type: Others
Protein ID: WP_000229317.1
Location: 839670..839927 (258 bp)
Type: Others
Protein ID: WP_000861987.1
Type: Others
Protein ID: WP_000861987.1
Location: 840129..840662 (534 bp)
Type: Others
Protein ID: WP_000118351.1
Type: Others
Protein ID: WP_000118351.1
Location: 840659..841084 (426 bp)
Type: Others
Protein ID: WP_001882332.1
Type: Others
Protein ID: WP_001882332.1
Location: 841151..841522 (372 bp)
Type: Others
Protein ID: WP_001164080.1
Type: Others
Protein ID: WP_001164080.1
Location: 841770..842030 (261 bp)
Type: Others
Protein ID: WP_032468027.1
Type: Others
Protein ID: WP_032468027.1
Location: 842048..842208 (161 bp)
Type: Others
Protein ID: Protein_742
Type: Others
Protein ID: Protein_742
Location: 842442..842666 (225 bp)
Type: Others
Protein ID: WP_161571222.1
Type: Others
Protein ID: WP_161571222.1
Location: 842996..843106 (111 bp)
Type: Others
Protein ID: WP_076025930.1
Type: Others
Protein ID: WP_076025930.1
Location: 843491..843793 (303 bp)
Type: Toxin
Protein ID: WP_000229325.1
Type: Toxin
Protein ID: WP_000229325.1
Location: 843781..844038 (258 bp)
Type: Antitoxin
Protein ID: WP_070961997.1
Type: Antitoxin
Protein ID: WP_070961997.1
Location: 844511..845491 (981 bp)
Type: Others
Protein ID: WP_000019368.1
Type: Others
Protein ID: WP_000019368.1
Location: 845561..845887 (327 bp)
Type: Others
Protein ID: Protein_748
Type: Others
Protein ID: Protein_748
Location: 847087..847239 (153 bp)
Type: Others
Protein ID: WP_001884520.1
Type: Others
Protein ID: WP_001884520.1
Location: 847561..848016 (456 bp)
Type: Others
Protein ID: WP_001245327.1
Type: Others
Protein ID: WP_001245327.1
Location: 848144..848431 (288 bp)
Type: Others
Protein ID: WP_000221354.1
Type: Others
Protein ID: WP_000221354.1
Location: 848421..848672 (252 bp)
Type: Others
Protein ID: WP_001250179.1
Type: Others
Protein ID: WP_001250179.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AP033_RS03795 | 839380..839682 | - | 303 | WP_000229317.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
AP033_RS03800 | 839670..839927 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
AP033_RS03805 | 840129..840662 | - | 534 | WP_000118351.1 | GNAT family N-acetyltransferase | - |
AP033_RS20035 | 840659..841084 | - | 426 | WP_001882332.1 | DUF1778 domain-containing protein | - |
AP033_RS03815 | 841151..841522 | - | 372 | WP_001164080.1 | nucleotide pyrophosphohydrolase | - |
AP033_RS03820 | 841770..842030 | - | 261 | WP_032468027.1 | DUF3709 domain-containing protein | - |
AP033_RS19075 | 842048..842208 | - | 161 | Protein_742 | DUF3709 domain-containing protein | - |
AP033_RS19080 | 842442..842666 | - | 225 | WP_161571222.1 | DUF3709 domain-containing protein | - |
AP033_RS19085 | 842996..843106 | - | 111 | WP_076025930.1 | DUF645 family protein | - |
AP033_RS03825 | 843491..843793 | - | 303 | WP_000229325.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
AP033_RS03830 | 843781..844038 | - | 258 | WP_070961997.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
AP033_RS03835 | 844511..845491 | - | 981 | WP_000019368.1 | IS5-like element ISVch5 family transposase | - |
AP033_RS03840 | 845561..845887 | - | 327 | Protein_748 | hypothetical protein | - |
AP033_RS03845 | 846118..846390 | + | 273 | WP_000246253.1 | DUF1778 domain-containing protein | - |
AP033_RS03850 | 846387..846884 | + | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
AP033_RS03855 | 847087..847239 | - | 153 | WP_001884520.1 | DUF645 family protein | - |
AP033_RS03860 | 847561..848016 | - | 456 | WP_001245327.1 | GNAT family N-acetyltransferase | - |
AP033_RS03865 | 848144..848431 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
AP033_RS03870 | 848421..848672 | - | 252 | WP_001250179.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 844511..845491 | 980 | ||
- | inside | Integron | - | - | 829699..942463 | 112764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11710.64 Da Isoelectric Point: 5.1972
>T57705 WP_000229325.1 NZ_CP013013:c843793-843491 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
>T57705 NZ_CP013013:c843793-843491 [Vibrio cholerae]
ATGGTTGAAATAATTTGGACGGAGCCGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCTCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
ATGGTTGAAATAATTTGGACGGAGCCGGCTCTATCCGACTTGAATGATATTGCTGAATACATCGCTCTTGAAAATGTCGT
GGCTGCTAAACAACTGGTGCAAACCGTTTTTACAAAAGTTGAACGTTTGGCCGATTTTCCAGAGTCTGGGCGCGTCCCTC
CAGAACTAGAACACCTCAATTATCGTGAAGTCGTTGTAAGTCCGTGTCGTGTTTTCTACAAGTATGATGATGCAAAGGTT
CGTATTCTTTTTGTTATGCGTGCGGAGCGAGATTTGCGTCGGTTAATGCTTACGAAACAGTAG
Antitoxin
Download Length: 86 a.a. Molecular weight: 9629.12 Da Isoelectric Point: 7.3178
>AT57705 WP_070961997.1 NZ_CP013013:c844038-843781 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRI
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRI
SKWLK
Download Length: 258 bp
>AT57705 NZ_CP013013:c844038-843781 [Vibrio cholerae]
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCTTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATA
TCAAAATGGTTGAAATAA
ATGAAAGTAGAACTTGTGACGTCACTAAAACGTCAGGCCACTAAGATCCTTGCCGATCTTCATGATACGAAAGAGCCAGT
ATTGATAACTGAGCACGGAAAACCGTCAGCTTACCTTATTGATGTAGACGACTATGAATTTATGCAAAATCGTTTAGCGA
TCTTGGAAGGTATTGCTCGCGGAGAGCGAGCTTTAGCGGATGGTAAAGTGGTCAGCCATCAAGATGCTAAGGACAGAATA
TCAAAATGGTTGAAATAA