Detailed information of TA system TA206604

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/RelE-MqsA
• Location: 12050..12683
• Replicon: chromosome
• Accession: NZ_CP077061
• Organism: Vibrio cholerae strain MS84A

Toxin (Protein)

• Gene name: higB
• Uniprot ID: Q9KMA6
• Locus tag: J3992_RS13645
• Protein ID: WP_000843587.1
• Coordinates: 12351..12683 (-)
• Length: 111 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: J3992_RS13640
• Protein ID: WP_000071008.1
• Coordinates: 12050..12364 (-)
• Length: 105 a.a.

Genomic Context

Location: 10051..11031 (981 bp)
Type: Others
Protein ID: WP_000019370.1

Location: 7104..7391 (288 bp)
Type: Others
Protein ID: WP_000221354.1

Location: 7381..7632 (252 bp)
Type: Others
Protein ID: WP_001250179.1

Location: 7846..8259 (414 bp)
Type: Others
Protein ID: WP_000049417.1

Location: 8334..8444 (111 bp)
Type: Others
Protein ID: WP_082798255.1

Location: 8447..8848 (402 bp)
Type: Others
Protein ID: WP_000351248.1

Location: 8848..9018 (171 bp)
Type: Others
Protein ID: WP_001080654.1

Location: 9142..9540 (399 bp)
Type: Others
Protein ID: Protein_23

Location: 9677..9983 (307 bp)
Type: Others
Protein ID: Protein_24

Location: 11156..11311 (156 bp)
Type: Others
Protein ID: WP_000751734.1

Location: 11479..11913 (435 bp)
Type: Others
Protein ID: WP_000256036.1

Location: 12050..12364 (315 bp)
Type: Antitoxin
Protein ID: WP_000071008.1

Location: 12351..12683 (333 bp)
Type: Toxin
Protein ID: WP_000843587.1

Location: 13024..13251 (228 bp)
Type: Others
Protein ID: WP_001894457.1

Location: 13200..13313 (114 bp)
Type: Others
Protein ID: WP_001889158.1

Location: 13479..13700 (222 bp)
Type: Others
Protein ID: WP_032468461.1

Location: 13709..13823 (115 bp)
Type: Others
Protein ID: Protein_33

Location: 13880..14257 (378 bp)
Type: Others
Protein ID: WP_000411109.1

Location: 14428..14781 (354 bp)
Type: Others
Protein ID: WP_080032710.1

Location: 14872..15258 (387 bp)
Type: Others
Protein ID: WP_000703163.1

Location: 15467..15599 (133 bp)
Type: Others
Protein ID: Protein_37

Location: 15590..15715 (126 bp)
Type: Others
Protein ID: WP_080360924.1

Location: 15956..16225 (270 bp)
Type: Others
Protein ID: WP_001198131.1

Location: 16585..16782 (198 bp)
Type: Others
Protein ID: WP_001894451.1

Location: 17039..17242 (204 bp)
Type: Others
Protein ID: WP_001911745.1

Location: 17383..17448 (66 bp)
Type: Others
Protein ID: Protein_42

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
J3992_RS13585 (J3992_13580)	7104..7391	-	288	WP_000221354.1	type II toxin-antitoxin system RelE/ParE family toxin	-
J3992_RS13590 (J3992_13585)	7381..7632	-	252	WP_001250179.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
J3992_RS13595 (J3992_13590)	7846..8259	-	414	WP_000049417.1	VOC family protein	-
J3992_RS13600 (J3992_13595)	8334..8444	-	111	WP_082798255.1	DUF3265 domain-containing protein	-
J3992_RS13605 (J3992_13600)	8447..8848	-	402	WP_000351248.1	type II toxin-antitoxin system death-on-curing family toxin	-
J3992_RS13610 (J3992_13605)	8848..9018	-	171	WP_001080654.1	hypothetical protein	-
J3992_RS13615 (J3992_13610)	9142..9540	-	399	Protein_23	GNAT family N-acetyltransferase	-
J3992_RS13620 (J3992_13615)	9677..9983	-	307	Protein_24	CatB-related O-acetyltransferase	-
J3992_RS13625 (J3992_13620)	10051..11031	+	981	WP_000019370.1	IS5-like element ISVch5 family transposase	-
J3992_RS13630 (J3992_13625)	11156..11311	-	156	WP_000751734.1	hypothetical protein	-
J3992_RS13635 (J3992_13630)	11479..11913	-	435	WP_000256036.1	GNAT family N-acetyltransferase	-
J3992_RS13640 (J3992_13635)	12050..12364	-	315	WP_000071008.1	DNA-binding transcriptional regulator	Antitoxin
J3992_RS13645 (J3992_13640)	12351..12683	-	333	WP_000843587.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
J3992_RS13650 (J3992_13645)	13024..13251	-	228	WP_001894457.1	DUF1289 domain-containing protein	-
J3992_RS13655 (J3992_13650)	13200..13313	-	114	WP_001889158.1	hypothetical protein	-
J3992_RS13660 (J3992_13655)	13479..13700	-	222	WP_032468461.1	DUF1289 domain-containing protein	-
J3992_RS13665 (J3992_13660)	13709..13823	-	115	Protein_33	acetyltransferase	-
J3992_RS13670 (J3992_13665)	13880..14257	-	378	WP_000411109.1	hypothetical protein	-
J3992_RS13675 (J3992_13670)	14428..14781	-	354	WP_080032710.1	pullulanase	-
J3992_RS13680 (J3992_13675)	14872..15258	-	387	WP_000703163.1	VOC family protein	-
J3992_RS13685 (J3992_13680)	15467..15599	-	133	Protein_37	DUF645 family protein	-
J3992_RS13690	15590..15715	-	126	WP_080360924.1	general secretion pathway protein GspH	-
J3992_RS13695 (J3992_13685)	15956..16225	-	270	WP_001198131.1	hypothetical protein	-
J3992_RS13700 (J3992_13690)	16585..16782	-	198	WP_001894451.1	DUF3709 domain-containing protein	-
J3992_RS13705 (J3992_13695)	17039..17242	-	204	WP_001911745.1	hypothetical protein	-
J3992_RS13710	17383..17448	-	66	Protein_42	acetyltransferase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integron	-	hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA	1..1044173	1044172
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002506 Vibrio cholerae O1 biovar El Tor str. N16961 IS/Tn TA000174, TA000175, TA000176, TA010030 416601..417581 0	flank	IS/Tn	-	-	10051..11031	980

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-2 (4-100)

Antitoxin

• Cro/C1-type helix-turn-helix domain (43-92)

Sequences

Toxin

Protein

• Length: 111 a.a.
• Molecular weight: 13005.95 Da
• Isoelectric Point: 9.9244

>T206604 WP_000843587.1 NZ_CP077061:c12683-12351 [Vibrio cholerae]
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLT
IYGKNEMSDLNANQRKQLMAFMEAWRNEQS

Nucleotide

• Length: 333 bp

>T206604 NZ_CP102500:4686776-4687093 [Citrobacter youngae]
ATCATGGAAATTCTTCAGACCACGGTTTTCCAACGCTGGGAACAGAATCTACGGGATCGCAGGGCCAAAACGCTCATTGC
CGCACGACTTTTTCGACTGGCGAATGGTTTAGCTGGCGATGTTAAACCTGTAGGGGAAGGCGTCAGCGAAATGCGCATTT
CTTACGGTCCTGGTTACAGGATTTACTTTAAACAGCATGGCTGCCGCATCATCATTTTGCTATGTGGTGGCGATAAAAGC
TCACAAGCTAACGATATCACCCTTGCAAAAGTGCTCGCCCGTTCACTGGATTATCAGGAGACCTTCCGCCATGAATAA

Antitoxin

Protein

• Length: 105 a.a.
• Molecular weight: 11696.20 Da
• Isoelectric Point: 6.7600

>AT206604 WP_000071008.1 NZ_CP077061:c12364-12050 [Vibrio cholerae]
MSNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVP
NGQAVTLLKLVQRHPETLSHIAEL

Nucleotide

• Length: 315 bp

>AT206604 NZ_CP102500:4687086-4687364 [Citrobacter youngae]
ATGAATAAGCTTACTCAGTACGATCCCGCAGCTGCGCTGGTTGATGATGAAGAAATTGCTGTATTTATGGCGGATGCCCT
CGAAACAGGCGATGCAACGTACATTGCAAAAGCATTGGGCGTGGTGGCACGCGCTAAGGGAATGGCGAGCATCGCGGCAG
AAACGGGGTTATCCCGCGAACAACTCTATCGCTCGTTTAGTGAGAAAGGAAACCCGACGCTGAAAACCACGCTGGCGGTG
ATGAAGGCGCTCGGTATTGGATTGACACTTAGAAAATAG

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 5JA9
• PDB: 8A0X
• PDB: 5MJE
• PDB: 5JA8
• PDB: 5JAA

Antitoxin

Loading, please wait

Source	ID	Structure
No matching records found