Detailed information of TA system TA000120

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): unclassified/-
• Location: 2976586..2977234
• Replicon: chromosome
• Accession: NC_000962
• Organism: Mycobacterium tuberculosis H37Rv

Toxin (Protein)

• Gene name: novel[antitoxin]
• Uniprot ID: P9WJ13
• Locus tag: Rv2653c
• Protein ID: NP_217169.1
• Coordinates: 2976586..2976909 (-)
• Length: 108 a.a.

Antitoxin (Protein)

• Gene name: novel[toxin]
• Uniprot ID: P9WJ11
• Locus tag: Rv2654c
• Protein ID: NP_217170.1
• Coordinates: 2976989..2977234 (-)
• Length: 82 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
Rv2650c	2973795..2975234	-	1440	NP_217166.1	prophage protein	-
Rv2651c	2975242..2975775	-	534	NP_217167.1	prophage protease	-
Rv2652c	2975928..2976554	-	627	NP_217168.1	prophage protein	-
Rv2653c	2976586..2976909	-	324	NP_217169.1	toxin	Toxin
Rv2654c	2976989..2977234	-	246	NP_217170.1	antitoxin	Antitoxin
Rv2655c	2977231..2978658	-	1428	NP_217171.1	prophage protein	-
Rv2656c	2978660..2979052	-	393	NP_217172.1	prophage protein	-
Rv2657c	2979049..2979309	-	261	NP_217173.1	prophage protein	-
Rv2658c	2979326..2979688	-	363	NP_217174.1	prophage protein	-
Rv2659c	2979691..2980818	-	1128	NP_217175.1	prophage integrase	-
Rv2660c	2980963..2981190	-	228	NP_217176.1	hypothetical protein	-
Rv2661c	2981187..2981576	-	390	NP_217177.1	hypothetical protein	-
Rv2662	2981482..2981754	+	273	NP_217178.1	hypothetical protein	-
Rv2663	2981853..2982086	+	234	NP_217179.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002755 Mycobacterium tuberculosis CDC1551 Prophage TA020454 2966695..2975604 0.003 View NC_009525 Mycobacterium tuberculosis H37Ra Prophage TA022180 2982519..2992786 0 View NC_009565 Mycobacterium tuberculosis F11 Prophage TA022241 2983868..2992777 0.003 View NC_012943 Mycobacterium tuberculosis KZN 1435 Prophage TA024036 1434355..1443264 0.003 View NC_016768 Mycobacterium tuberculosis KZN 4207 Prophage TA025818 1434299..1443208 0.003 View NC_017522 Mycobacterium tuberculosis CCDC5180 Prophage TA026867 2958755..2967664 0.003 View NC_017524 Mycobacterium tuberculosis CTRI-2 Prophage TA026928 2965453..2974362 0.003 View NC_018078 Mycobacterium tuberculosis KZN 605 Prophage TA027962 1434467..1443376 0.003 View NC_018143 Mycobacterium tuberculosis H37Rv Prophage TA028104 2970561..2980828 0 View NC_020089 Mycobacterium tuberculosis 7199-99 Prophage TA028771 2971147..2980056 0.003 View NC_020559 Mycobacterium tuberculosis str. Erdman = ATCC 35801 Prophage TA029180 2958792..2967701 0.003 View NC_021251 Mycobacterium tuberculosis CCDC5079 Prophage TA029489 2965085..2973994 0.003 View NC_021740 Mycobacterium tuberculosis EAI5 Prophage TA029747 2958336..2967248 0.003 View NC_022350 Mycobacterium tuberculosis str. Haarlem Prophage TA030058 2965811..2974720 0.004 View NZ_AP014573 Mycobacterium tuberculosis str. Kurono Prophage TA030746 2974950..2985217 0 View NZ_AP017901 Mycobacterium tuberculosis strain NCGM946K2 Prophage TA031408 2956482..2966749 0 View NZ_AP018034 Mycobacterium tuberculosis strain HN-205 Prophage TA031556 2958919..2967828 0.003 View NZ_AP018035 Mycobacterium tuberculosis strain HN-321 Prophage TA031616 2972456..2981365 0.004 View NZ_AP018036 Mycobacterium tuberculosis strain HN-506 Prophage TA031676 2960709..2969618 0.003 View NZ_AP024671 Mycobacterium tuberculosis strain R2092 Prophage TA039191 2938412..2947321 0.003 View NZ_CP002871 Mycobacterium tuberculosis HKBS1 Prophage TA044642 2962518..2971427 0.003 View NZ_CP002882 Mycobacterium tuberculosis BT2 Prophage TA044702 2952748..2961657 0.004 View NZ_CP002883 Mycobacterium tuberculosis BT1 Prophage TA044762 2960145..2969054 0.003 View NZ_CP002885 Mycobacterium tuberculosis CCDC5180 Prophage TA044822 2963330..2972239 0.003 View NZ_CP007027 Mycobacterium tuberculosis H37RvSiena Prophage TA045926 2969939..2980206 0 View NZ_CP007803 Mycobacterium tuberculosis K Prophage TA047132 2953164..2962073 0.003 View NZ_CP007809 Mycobacterium tuberculosis strain KIT87190 Prophage TA047198 2962503..2971412 0.003 View NZ_CP009100 Mycobacterium tuberculosis strain ZMC13-264 Prophage TA048282 2970562..2980828 0 View NZ_CP009101 Mycobacterium tuberculosis strain ZMC13-88 Prophage TA048342 2970573..2980839 0 View NZ_CP009426 Mycobacterium tuberculosis strain 96075 Prophage TA048918 2949194..2958103 0.004 View NZ_CP009427 Mycobacterium tuberculosis strain 96121 Prophage TA048979 2980758..2989667 0.004 View NZ_CP010330 Mycobacterium tuberculosis strain F28 Prophage TA052099 2979563..2989830 0 View NZ_CP010339 Mycobacterium tuberculosis strain 22103 Prophage TA052160 2970084..2978993 0.003 View NZ_CP011510 Mycobacterium tuberculosis strain Beijing Prophage TA054379 389660..398569 0.004 View NZ_CP012090 Mycobacterium tuberculosis W-148 Prophage TA055670 2744974..2756970 0.005 View NZ_CP012506 Mycobacterium tuberculosis strain SCAID 187.0 Prophage TA056586 2965574..2975841 0 View NZ_CP013475 Mycobacterium tuberculosis strain 1458 Prophage TA058777 2953619..2962528 0.003 View NZ_CP016794 Mycobacterium tuberculosis strain SCAID 320.0 Prophage TA065080 2966673..2976650 0.001 View NZ_CP016888 Mycobacterium tuberculosis strain SCAID 252.0 Prophage TA065381 2968551..2978821 0 View NZ_CP016972 Mycobacterium tuberculosis H37Ra Prophage TA065757 2983715..2993982 0 View NZ_CP017593 Mycobacterium tuberculosis strain Beijing-like/35049 Prophage TA067485 2979204..2988113 0.003 View NZ_CP017594 Mycobacterium tuberculosis strain Beijing-like/36918 Prophage TA067545 2993037..3001946 0.003 View NZ_CP017595 Mycobacterium tuberculosis strain Beijing-like/38774 Prophage TA067605 2982336..2991245 0.003 View NZ_CP017596 Mycobacterium tuberculosis strain Beijing/391 Prophage TA067665 2965100..2974009 0.003 View NZ_CP017597 Mycobacterium tuberculosis strain Beijing-like/50148 Prophage TA067725 2996838..3005747 0.003 View NZ_CP017598 Mycobacterium tuberculosis strain Beijing-like/1104 Prophage TA067785 2969574..2978483 0.004 View NZ_CP017920 Mycobacterium tuberculosis strain TB282 Prophage TA068290 396957..405867 0.003 View NZ_CP018300 Mycobacterium tuberculosis strain I0002353-6 Prophage TA069351 2956071..2964980 0.003 View NZ_CP018301 Mycobacterium tuberculosis strain I0002801-4 Prophage TA069412 2952098..2961007 0.003 View NZ_CP018302 Mycobacterium tuberculosis strain I0004000-1 Prophage TA069472 2954693..2964960 0 View NZ_CP018303 Mycobacterium tuberculosis strain I0004241-1 Prophage TA069533 2955150..2964059 0.004 View NZ_CP018304 Mycobacterium tuberculosis strain M0002959-6 Prophage TA069594 2959433..2968342 0.004 View NZ_CP018305 Mycobacterium tuberculosis strain M0018684-2 Prophage TA069655 2955907..2964816 0.003 View NZ_CP018778 Mycobacterium tuberculosis strain DK9897 Prophage TA070494 2970554..2980821 0 View NZ_CP019610 Mycobacterium tuberculosis strain H54 Prophage TA072868 3985130..3994039 0.003 View NZ_CP019611 Mycobacterium tuberculosis strain H83 Prophage TA072927 3750838..3759747 0.004 View NZ_CP019612 Mycobacterium tuberculosis strain H107 Prophage TA072983 2836846..2846183 0.004 View NZ_CP019613 Mycobacterium tuberculosis strain H112 Prophage TA073003 447965..456874 0.004 View NZ_CP020381 Mycobacterium tuberculosis strain MTB1 Prophage TA074539 2971455..2980364 0.003 View NZ_CP022014 Mycobacterium tuberculosis strain MTB2 Prophage TA078163 2975178..2984087 0.003 View NZ_CP022577 Mycobacterium tuberculosis strain WC078 Prophage TA079262 716767..725676 0.003 View NZ_CP022578 Mycobacterium tuberculosis strain WC059 Prophage TA079321 572292..581201 0.003 View NZ_CP023573 Mycobacterium tuberculosis strain CSV4519 Prophage TA081711 2970320..2980587 0 View NZ_CP023574 Mycobacterium tuberculosis strain CSV4644 Prophage TA081771 2970359..2980626 0 View NZ_CP023575 Mycobacterium tuberculosis strain CSV5769 Prophage TA081832 2970394..2980661 0 View NZ_CP023576 Mycobacterium tuberculosis strain CSV10399 Prophage TA081893 2970281..2980548 0 View NZ_CP023577 Mycobacterium tuberculosis strain CSV11678 Prophage TA081954 2970474..2980741 0 View NZ_CP023578 Mycobacterium tuberculosis strain LE486 Prophage TA082014 2970253..2980518 0 View NZ_CP023579 Mycobacterium tuberculosis strain LE492 Prophage TA082074 2970270..2980535 0 View NZ_CP023580 Mycobacterium tuberculosis strain LN180 Prophage TA082135 2970479..2980746 0 View NZ_CP023581 Mycobacterium tuberculosis strain LN2358 Prophage TA082196 2970432..2980699 0 View NZ_CP023582 Mycobacterium tuberculosis strain LN3756 Prophage TA082257 2970402..2980669 0 View NZ_CP023583 Mycobacterium tuberculosis strain MDRDM260 Prophage TA082318 2970367..2980634 0 View NZ_CP023584 Mycobacterium tuberculosis strain MDRDM627 Prophage TA082379 2970315..2980581 0 View NZ_CP023585 Mycobacterium tuberculosis strain MDRDM1098 Prophage TA082440 2970245..2980512 0 View NZ_CP023586 Mycobacterium tuberculosis strain MDRMA2491 Prophage TA082500 2970232..2980499 0 View NZ_CP023587 Mycobacterium tuberculosis strain ME1473 Prophage TA082560 2970293..2980558 0 View NZ_CP023588 Mycobacterium tuberculosis strain TBDM425 Prophage TA082621 2970216..2980483 0 View NZ_CP023589 Mycobacterium tuberculosis strain TBV5000 Prophage TA082682 2970343..2980610 0 View NZ_CP023590 Mycobacterium tuberculosis strain TBV5362 Prophage TA082743 2970370..2980637 0 View NZ_CP023591 Mycobacterium tuberculosis strain TBV5365 Prophage TA082804 2970446..2980713 0 View NZ_CP023592 Mycobacterium tuberculosis strain SLM036 Prophage TA082865 2970367..2980634 0 View NZ_CP023593 Mycobacterium tuberculosis strain SLM040 Prophage TA082925 2970485..2980752 0 View NZ_CP023594 Mycobacterium tuberculosis strain SLM056 Prophage TA082986 2970461..2980728 0 View NZ_CP023595 Mycobacterium tuberculosis strain SLM060 Prophage TA083046 2970258..2980525 0 View NZ_CP023596 Mycobacterium tuberculosis strain SLM063 Prophage TA083107 2970456..2980723 0 View NZ_CP023597 Mycobacterium tuberculosis strain SLM088 Prophage TA083168 2970485..2980752 0 View NZ_CP023598 Mycobacterium tuberculosis strain SLM100 Prophage TA083229 2970485..2980752 0 View NZ_CP023599 Mycobacterium tuberculosis strain CSV383 Prophage TA083289 2970242..2980509 0 View NZ_CP023600 Mycobacterium tuberculosis strain CSV3611 Prophage TA083350 2970453..2980722 0 View NZ_CP023601 Mycobacterium tuberculosis strain CSV9577 Prophage TA083411 2970386..2980653 0 View NZ_CP023602 Mycobacterium tuberculosis strain LE13 Prophage TA083472 2970451..2980718 0 View NZ_CP023603 Mycobacterium tuberculosis strain LE63 Prophage TA083533 2970473..2980740 0 View NZ_CP023604 Mycobacterium tuberculosis strain LE76 Prophage TA083594 2970293..2980560 0 View NZ_CP023605 Mycobacterium tuberculosis strain LE79 Prophage TA083655 2970503..2980770 0 View NZ_CP023606 Mycobacterium tuberculosis strain LE103 Prophage TA083716 2970395..2980662 0 View NZ_CP023607 Mycobacterium tuberculosis strain LE371 Prophage TA083777 2970300..2980567 0 View NZ_CP023608 Mycobacterium tuberculosis strain LE410 Prophage TA083838 2970460..2980361 0.001 View NZ_CP023609 Mycobacterium tuberculosis strain LN55 Prophage TA083898 2970311..2980578 0 View NZ_CP023610 Mycobacterium tuberculosis strain LN317 Prophage TA083959 2970421..2980688 0 View NZ_CP023611 Mycobacterium tuberculosis strain LN763 Prophage TA084020 2970351..2980618 0 View NZ_CP023612 Mycobacterium tuberculosis strain LN2978 Prophage TA084081 2970436..2980703 0 View NZ_CP023613 Mycobacterium tuberculosis strain LN3584 Prophage TA084142 2970432..2980699 0 View NZ_CP023614 Mycobacterium tuberculosis strain LN3588 Prophage TA084203 2970414..2980681 0 View NZ_CP023615 Mycobacterium tuberculosis strain LN3589 Prophage TA084264 2970428..2980695 0 View NZ_CP023616 Mycobacterium tuberculosis strain LN3668 Prophage TA084325 2970529..2980796 0 View NZ_CP023617 Mycobacterium tuberculosis strain LN3672 Prophage TA084386 2970503..2980770 0 View NZ_CP023618 Mycobacterium tuberculosis strain LN3695 Prophage TA084447 2970479..2980746 0 View NZ_CP023619 Mycobacterium tuberculosis strain LN1100 Prophage TA084508 2970488..2980755 0 View NZ_CP023620 Mycobacterium tuberculosis strain LN1856 Prophage TA084569 2970339..2980606 0 View NZ_CP023621 Mycobacterium tuberculosis strain LN2900 Prophage TA084630 2970350..2980617 0 View NZ_CP023622 Mycobacterium tuberculosis strain MDRDM827 Prophage TA084691 2970340..2980607 0 View NZ_CP023623 Mycobacterium tuberculosis strain MDRMA203 Prophage TA084752 2970443..2980710 0 View NZ_CP023624 Mycobacterium tuberculosis strain MDRMA701 Prophage TA084813 2970363..2980630 0 View NZ_CP023625 Mycobacterium tuberculosis strain MDRMA863 Prophage TA084873 2970492..2980759 0 View NZ_CP023626 Mycobacterium tuberculosis strain MDRMA1565 Prophage TA084933 2970274..2980541 0 View NZ_CP023627 Mycobacterium tuberculosis strain MDRMA2019 Prophage TA084993 2970280..2980545 0 View NZ_CP023628 Mycobacterium tuberculosis strain MDRMA2082 Prophage TA085054 2970518..2980785 0 View NZ_CP023629 Mycobacterium tuberculosis strain MDRMA2260 Prophage TA085115 2970384..2980651 0 View NZ_CP023630 Mycobacterium tuberculosis strain MDRMA2441 Prophage TA085176 2970467..2980734 0 View NZ_CP023631 Mycobacterium tuberculosis strain TBDM1506 Prophage TA085236 2970335..2980602 0.001 View NZ_CP023632 Mycobacterium tuberculosis strain TBDM2189 Prophage TA085297 2970385..2980652 0 View NZ_CP023633 Mycobacterium tuberculosis strain TBDM2444 Prophage TA085358 2970342..2980609 0 View NZ_CP023634 Mycobacterium tuberculosis strain TBDM2487 Prophage TA085419 2970416..2980683 0 View NZ_CP023635 Mycobacterium tuberculosis strain TBDM2489 Prophage TA085480 2970391..2980658 0 View NZ_CP023636 Mycobacterium tuberculosis strain TBDM2699 Prophage TA085541 2970514..2980781 0 View NZ_CP023637 Mycobacterium tuberculosis strain TBDM2717 Prophage TA085602 2970500..2980767 0 View NZ_CP023638 Mycobacterium tuberculosis strain TBV4766 Prophage TA085663 2970336..2980603 0 View NZ_CP023639 Mycobacterium tuberculosis strain TBV4768 Prophage TA085723 2970274..2980541 0 View NZ_CP023640 Mycobacterium tuberculosis strain TBV4952 Prophage TA085784 2970484..2980751 0 View NZ_CP025593 Mycobacterium tuberculosis strain GG-111-10 Prophage TA090676 2970554..2980821 0 View NZ_CP025594 Mycobacterium tuberculosis strain GG-5-10 Prophage TA090737 2970502..2980769 0 View NZ_CP025595 Mycobacterium tuberculosis strain GG-20-11 Prophage TA090798 2970538..2980805 0 View NZ_CP025596 Mycobacterium tuberculosis strain GG-27-11 Prophage TA090859 2970456..2980723 0 View NZ_CP025597 Mycobacterium tuberculosis strain GG-36-11 Prophage TA090919 2970521..2980788 0 View NZ_CP025598 Mycobacterium tuberculosis strain GG-37-11 Prophage TA090980 2970548..2980823 0 View NZ_CP025599 Mycobacterium tuberculosis strain GG-45-11 Prophage TA091041 2970522..2980789 0 View NZ_CP025600 Mycobacterium tuberculosis strain GG-77-11 Prophage TA091102 2970531..2980798 0 View NZ_CP025601 Mycobacterium tuberculosis strain GG-90-10 Prophage TA091163 2970575..2980850 0 View NZ_CP025602 Mycobacterium tuberculosis strain GG-109-10 Prophage TA091224 2970490..2980757 0 View NZ_CP025603 Mycobacterium tuberculosis strain GG-121-10 Prophage TA091285 2970526..2980793 0 View NZ_CP025604 Mycobacterium tuberculosis strain GG-129-11 Prophage TA091346 2970449..2980716 0 View NZ_CP025605 Mycobacterium tuberculosis strain GG-134-11 Prophage TA091407 2970497..2980764 0 View NZ_CP025606 Mycobacterium tuberculosis strain GG-137-10 Prophage TA091468 2970522..2980789 0 View NZ_CP025607 Mycobacterium tuberculosis strain GG-186-10 Prophage TA091529 2970542..2980809 0 View NZ_CP025608 Mycobacterium tuberculosis strain GG-229-10 Prophage TA091590 2970529..2980799 0 View NZ_CP029065 Mycobacterium tuberculosis strain TBMENG-03 Prophage TA104725 2946141..2955050 0.004 View NZ_CP030093 Mycobacterium tuberculosis strain RUS_B0 Prophage TA107076 2745009..2757005 0.005 View NZ_CP041207 Mycobacterium tuberculosis strain MT-0080 Prophage TA127831 2980514..2989422 0.004 View NZ_CP041788 Mycobacterium tuberculosis strain SEA17020030P6C4 Prophage TA129302 2973989..2982898 0.003 View NZ_CP041789 Mycobacterium tuberculosis strain SEA17020028P6C4 Prophage TA129362 2967897..2976806 0.003 View NZ_CP041796 Mycobacterium tuberculosis strain SEA14318P6C4 Prophage TA129781 2980526..2989434 0.004 View NZ_CP041797 Mycobacterium tuberculosis strain SEA14117P6C4 Prophage TA129842 2956712..2965621 0.004 View NZ_CP041799 Mycobacterium tuberculosis strain SEA13020298P6C4 Prophage TA129951 2745015..2757011 0.005 View NZ_CP041800 Mycobacterium tuberculosis strain SEA12334P6C4 Prophage TA130022 2991600..3000507 0.005 View NZ_CP041801 Mycobacterium tuberculosis strain SEA12202P6C4 Prophage TA130082 2994987..3003896 0.004 View NZ_CP041804 Mycobacterium tuberculosis strain SEA11020092P6C4 Prophage TA130261 2971961..2980870 0.003 View NZ_CP041805 Mycobacterium tuberculosis strain SEA11020068P6C4 Prophage TA130322 2968329..2977237 0.004 View NZ_CP041806 Mycobacterium tuberculosis strain SEA11020057P6C4 Prophage TA130383 2957389..2966298 0.003 View NZ_CP041808 Mycobacterium tuberculosis strain SEA09167P6C4 Prophage TA130503 2956592..2965501 0.003 View NZ_CP041809 Mycobacterium tuberculosis strain SEA09020048P6C4 Prophage TA130564 2958760..2967669 0.003 View NZ_CP041810 Mycobacterium tuberculosis strain SEA08162P6C4 Prophage TA130625 2967990..2976899 0.003 View NZ_CP041811 Mycobacterium tuberculosis strain SEA08151P6C4 Prophage TA130686 2974652..2983561 0.004 View NZ_CP041812 Mycobacterium tuberculosis strain SEA07020250P6C4 Prophage TA130747 2972216..2981125 0.003 View NZ_CP041813 Mycobacterium tuberculosis strain SEA07010354P6C4 Prophage TA130807 2993810..3002719 0.003 View NZ_CP041814 Mycobacterium tuberculosis strain SEA06535P6C4 Prophage TA130868 2976377..2983400 0.01 View NZ_CP041815 Mycobacterium tuberculosis strain SEA02010036P6C4 Prophage TA130918 2745021..2757017 0.005 View NZ_CP041816 Mycobacterium tuberculosis strain SEA00042P6C4 Prophage TA130989 2977914..2986823 0.003 View NZ_CP041817 Mycobacterium tuberculosis strain 4-0096P6C4 Prophage TA131050 2965100..2974009 0.004 View NZ_CP041818 Mycobacterium tuberculosis strain 4-0087P6C4 Prophage TA131110 2977329..2986238 0.003 View NZ_CP041819 Mycobacterium tuberculosis strain 4-0077P6C4 Prophage TA131171 2959939..2968848 0.004 View NZ_CP041820 Mycobacterium tuberculosis strain 4-0073P6C4 Prophage TA131232 2980952..2989860 0.004 View NZ_CP041821 Mycobacterium tuberculosis strain 4-0062P6C4 Prophage TA131293 2958329..2967238 0.004 View NZ_CP041822 Mycobacterium tuberculosis strain 4-0024P6C4 Prophage TA131331 1434197..1443106 0.003 View NZ_CP041823 Mycobacterium tuberculosis strain 4-0019P6C4 Prophage TA131392 1434253..1443162 0.003 View NZ_CP041824 Mycobacterium tuberculosis strain 4-0012P6C4 Prophage TA131476 2968703..2977612 0.003 View NZ_CP041825 Mycobacterium tuberculosis strain 4-0010P6C4 Prophage TA131513 1434253..1443162 0.003 View NZ_CP041826 Mycobacterium tuberculosis strain 3-0124P6C4 Prophage TA131595 3004051..3012960 0.004 View NZ_CP041827 Mycobacterium tuberculosis strain 3-0096P6C4 Prophage TA131656 2997136..3006045 0.004 View NZ_CP041828 Mycobacterium tuberculosis strain 3-0090P6C4 Prophage TA131717 2985819..2994728 0.004 View NZ_CP041829 Mycobacterium tuberculosis strain 3-0059P6C4 Prophage TA131778 2961287..2970196 0.003 View NZ_CP041830 Mycobacterium tuberculosis strain 2-0068P6C4 Prophage TA131837 2968960..2977869 0.003 View NZ_CP041831 Mycobacterium tuberculosis strain 2-0059P6C4 Prophage TA131898 2982806..2991714 0.004 View NZ_CP041832 Mycobacterium tuberculosis strain 2-0052P6C4 Prophage TA131958 2961006..2969915 0.003 View NZ_CP041833 Mycobacterium tuberculosis strain 2-0046P6C4 Prophage TA132019 2983905..2992814 0.003 View NZ_CP041834 Mycobacterium tuberculosis strain 2-0043-unknownP6C4 Prophage TA132080 2968249..2977158 0.003 View NZ_CP041835 Mycobacterium tuberculosis strain 2-0034P6C4 Prophage TA132140 2961128..2970038 0.004 View NZ_CP041836 Mycobacterium tuberculosis strain 2-0031P6C4 Prophage TA132190 2744997..2756993 0.005 View NZ_CP041837 Mycobacterium tuberculosis strain 2-0029P6C4 Prophage TA132261 2984033..2992942 0.003 View NZ_CP041838 Mycobacterium tuberculosis strain 2-0028P6C4 Prophage TA132322 2983948..2992857 0.003 View NZ_CP041839 Mycobacterium tuberculosis strain 2-0023P6C4 Prophage TA132383 2984035..2992944 0.003 View NZ_CP041840 Mycobacterium tuberculosis strain 2-0022P6C4 Prophage TA132444 2984019..2992928 0.003 View NZ_CP041841 Mycobacterium tuberculosis strain 2-0021P6C4 Prophage TA132505 2983956..2992865 0.003 View NZ_CP041842 Mycobacterium tuberculosis strain 2-0013P6C4 Prophage TA132565 2967451..2976359 0.003 View NZ_CP041843 Mycobacterium tuberculosis strain 1-0168P6C4 Prophage TA132626 2969118..2978027 0.003 View NZ_CP041844 Mycobacterium tuberculosis strain 1-0160P6C4 Prophage TA132686 2987386..2996293 0.004 View NZ_CP041845 Mycobacterium tuberculosis strain 1-0156P6C4 Prophage TA132747 2980487..2989396 0.004 View NZ_CP041846 Mycobacterium tuberculosis strain 1-0153P6C4 Prophage TA132807 2966496..2975405 0.003 View NZ_CP041847 Mycobacterium tuberculosis strain 1-0149P6C4 Prophage TA132867 2968206..2977115 0.003 View NZ_CP041848 Mycobacterium tuberculosis strain 1-0137P6C4 Prophage TA132927 2966731..2975640 0.004 View NZ_CP041849 Mycobacterium tuberculosis strain 1-0123P6C4 Prophage TA132987 2970966..2979875 0.004 View NZ_CP041850 Mycobacterium tuberculosis strain 1-0116P6C4 Prophage TA133047 2965188..2974097 0.004 View NZ_CP041853 Mycobacterium tuberculosis strain 1-0107P6C4 Prophage TA133225 2998723..3007632 0.003 View NZ_CP041854 Mycobacterium tuberculosis strain 1-0102P6C4 Prophage TA133285 2969558..2978466 0.003 View NZ_CP041855 Mycobacterium tuberculosis strain 1-0084P6C4 Prophage TA133345 2968212..2977121 0.003 View NZ_CP041856 Mycobacterium tuberculosis strain 1-0071P6C4 Prophage TA133405 2964830..2973739 0.004 View NZ_CP041857 Mycobacterium tuberculosis strain 1-0069P6C4 Prophage TA133465 2964826..2973735 0.004 View NZ_CP041858 Mycobacterium tuberculosis strain 1-0064P6C4 Prophage TA133525 2967561..2976471 0.003 View NZ_CP041860 Mycobacterium tuberculosis strain 1-0056P6C4 Prophage TA133645 2969955..2978864 0.003 View NZ_CP041861 Mycobacterium tuberculosis strain 1-0054P6C4 Prophage TA133705 2968100..2977009 0.003 View NZ_CP041862 Mycobacterium tuberculosis strain 1-0047P6C4 Prophage TA133764 2987998..2996907 0.003 View NZ_CP041863 Mycobacterium tuberculosis strain 1-0045P6C4 Prophage TA133824 2965366..2974275 0.004 View NZ_CP041864 Mycobacterium tuberculosis strain 1-0044P6C4 Prophage TA133885 2952053..2960962 0.004 View NZ_CP041866 Mycobacterium tuberculosis strain 1-0036P6C4 Prophage TA134002 2969134..2978043 0.003 View NZ_CP041867 Mycobacterium tuberculosis strain 1-0031P6C4 Prophage TA134062 2968207..2977116 0.003 View NZ_CP041869 Mycobacterium tuberculosis strain 1-0028P6C4 Prophage TA134182 2965374..2974283 0.004 View NZ_CP041870 Mycobacterium tuberculosis strain 1-0023P6C4 Prophage TA134242 2970764..2979673 0.004 View NZ_CP041871 Mycobacterium tuberculosis strain 1-0021P6C4 Prophage TA134301 2982125..2991033 0.004 View NZ_CP041872 Mycobacterium tuberculosis strain 1-0017P6C4 Prophage TA134361 2968211..2977120 0.003 View NZ_CP041873 Mycobacterium tuberculosis strain 1-0013P6C4 Prophage TA134421 2976035..2984944 0.003 View NZ_CP041874 Mycobacterium tuberculosis strain 1-0009P6C4 Prophage TA134481 2968204..2977113 0.003 View NZ_CP041875 Mycobacterium tuberculosis strain 1-0007P6C4 Prophage TA134541 2992814..3001723 0.003 View NZ_CP041876 Mycobacterium tuberculosis strain 1-0006P6C4 Prophage TA134601 2970695..2979604 0.004 View NZ_CP043995 Mycobacterium tuberculosis strain 4-0041P6C4 Prophage TA139710 1434247..1443156 0.003 View NZ_CP043996 Mycobacterium tuberculosis strain 1-0072P6C4 Prophage TA139793 2971199..2980108 0.003 View NZ_CP043997 Mycobacterium tuberculosis strain 1-0066P6C4 Prophage TA139853 2965373..2974282 0.004 View NZ_CP046308 Mycobacterium tuberculosis strain FDAARGOS_751 Prophage TA143904 1645805..1654714 0.004 View NZ_CP046309 Mycobacterium tuberculosis strain FDAARGOS_750 Prophage TA143959 1059683..1068592 0.004 View NZ_CP046529 Mycobacterium tuberculosis strain SIT745/EAI1-MYS Prophage TA144448 2976662..2985575 0.003 View NZ_CP046728 Mycobacterium tuberculosis strain TCDC11 Prophage TA144808 2966582..2975491 0.003 View NZ_CP048071 Mycobacterium tuberculosis strain RW-TB008 Prophage TA148824 2967262..2976171 0.004 View NZ_CP053092 Mycobacterium tuberculosis strain 4860 Prophage TA156067 2958105..2967014 0.003 View NZ_CP054013 Mycobacterium tuberculosis strain FDAARGOS_757 Prophage TA158443 3814718..3824985 0 View NZ_CP054014 Mycobacterium tuberculosis strain FDAARGOS_756 Prophage TA158459 254488..263398 0.003 View NZ_CP058236 Mycobacterium tuberculosis strain 060827 Prophage TA166366 2993724..3002633 0.004 View NZ_CP069067 Mycobacterium tuberculosis strain N1268 Prophage TA189203 2986652..2995561 0.004 View NZ_CP069068 Mycobacterium tuberculosis strain N1272 Prophage TA189264 2975215..2984127 0.004 View NZ_CP069069 Mycobacterium tuberculosis strain N1176 Prophage TA189325 2983738..2992647 0.004 View NZ_CP069070 Mycobacterium tuberculosis strain N1283 Prophage TA189386 2980242..2989150 0.004 View NZ_CP069071 Mycobacterium tuberculosis strain N0136 Prophage TA189447 2964434..2973343 0.003 View NZ_CP069072 Mycobacterium tuberculosis strain N1216 Prophage TA189508 2970931..2979840 0.004 View NZ_CP069073 Mycobacterium tuberculosis strain N0054 Prophage TA189568 2982115..2991024 0.003 View NZ_CP069074 Mycobacterium tuberculosis strain N1274 Prophage TA189629 2996475..3005383 0.003 View NZ_CP069075 Mycobacterium tuberculosis strain N0004 Prophage TA189689 2977673..2986582 0.004 View NZ_CP069076 Mycobacterium tuberculosis strain N0031 Prophage TA189750 2957992..2966901 0.003 View NZ_CP069078 Mycobacterium tuberculosis strain N0157 Prophage TA189871 2965602..2974511 0.004 View NZ_CP070338 Mycobacterium tuberculosis strain 11502 Prophage TA193875 2747674..2759670 0.005 View NZ_CP071127 Mycobacterium tuberculosis strain 120/26CAO Prophage TA195376 2970543..2980810 0 View NZ_CP071128 Mycobacterium tuberculosis strain 267/47W148 Prophage TA195437 2970547..2980814 0 View NZ_CP072761 Mycobacterium tuberculosis strain CG24 Prophage TA198427 3018998..3029265 0 View NZ_CP072762 Mycobacterium tuberculosis strain CG23 Prophage TA198488 2992062..3002329 0 View NZ_CP072763 Mycobacterium tuberculosis strain CG21 Prophage TA198549 2975548..2985815 0 View NZ_CP072764 Mycobacterium tuberculosis strain CG20 Prophage TA198610 2975547..2985814 0 View NZ_CP072765 Mycobacterium tuberculosis strain H37Rv_CG Prophage TA198671 2975548..2985815 0 View NZ_CP089610 Mycobacterium tuberculosis strain I0004290-8 Prophage TA228488 2981638..2990547 0.003 View NZ_CP089611 Mycobacterium tuberculosis strain I0004240-3 Prophage TA228549 2957790..2966699 0.003 View NZ_CP089772 Mycobacterium tuberculosis strain I0003165-3 Prophage TA228707 2971954..2980863 0.003 View NZ_CP089773 Mycobacterium tuberculosis strain 01-R1430 Prophage TA228767 2973339..2982248 0.004 View NZ_CP089774 Mycobacterium tuberculosis strain 02-R0894 Prophage TA228828 2966556..2975465 0.003 View NZ_CP089775 Mycobacterium tuberculosis strain 02-R1708 Prophage TA228889 2971063..2979972 0.003 View NZ_CP089776 Mycobacterium tuberculosis strain 02-R1896 Prophage TA228950 2962585..2971494 0.003 View NZ_CP089777 Mycobacterium tuberculosis strain I0003270-1 Prophage TA229010 2987771..2996680 0.004 View NZ_CP089778 Mycobacterium tuberculosis strain I0003758-5 Prophage TA229070 2981724..2990633 0.004 View NZ_CP089779 Mycobacterium tuberculosis strain 01-R1134 Prophage TA229095 1283373..1292282 0.003 View NZ_CP089780 Mycobacterium tuberculosis strain M0003941-3 Prophage TA229191 2967491..2976400 0.003 View NZ_CP089781 Mycobacterium tuberculosis strain 02-R1179 Prophage TA229252 2957759..2966668 0.003 View NZ_CP089927 Mycobacterium tuberculosis strain M20 Prophage TA229676 1895854..1906121 0 View NZ_CP095020 Mycobacterium tuberculosis strain SGF0232017 Prophage TA240997 2965177..2974086 0.004 View NZ_CP095021 Mycobacterium tuberculosis strain SGF0422017 Prophage TA241057 2961067..2969976 0.003 View NZ_CP095022 Mycobacterium tuberculosis strain SGF0472017 Prophage TA241117 2967615..2976524 0.003 View NZ_CP095023 Mycobacterium tuberculosis strain SGF0702019 Prophage TA241177 2969077..2977986 0.004 View NZ_CP110619 Mycobacterium tuberculosis strain H37Rv-1 Prophage TA264014 2974190..2984457 0 View NZ_CP110674 Mycobacterium tuberculosis strain BLR-31d Prophage TA264166 2745027..2757023 0.005 View NZ_CP115447 Mycobacterium tuberculosis strain BLR 9248 2019 Prophage TA267124 2746388..2758384 0.005 View NZ_CP125620 Mycobacterium tuberculosis strain BLR 4299 2019 Prophage TA282209 2955347..2964256 0.003 View NZ_CP127273 Mycobacterium tuberculosis strain 3320 Prophage TA283794 2953533..2963800 0 View NZ_CP127274 Mycobacterium tuberculosis strain 17221 Prophage TA283854 2954485..2964752 0 View NZ_CP127275 Mycobacterium tuberculosis strain 6721 Prophage TA283915 2949660..2959927 0 View NZ_CP127276 Mycobacterium tuberculosis strain 5521 Prophage TA283976 2955359..2965626 0 View NZ_CP127277 Mycobacterium tuberculosis strain 25421 Prophage TA284037 2952609..2962876 0 View NZ_HG813240 Mycobacterium tuberculosis 49-02 Prophage TA285100 2965981..2974891 0.003 View NZ_LR027516 Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis Prophage TA285969 2978550..2987459 0.003 View NZ_LR882496 Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole Prophage TA289707 2962637..2971550 0.004 View NZ_LR882497 Mycobacterium tuberculosis variant microti strain Maus IV isolate human Prophage TA289767 2973867..2984807 0.009 View NZ_LR882498 Mycobacterium tuberculosis variant microti strain Maus III isolate human Prophage TA289827 2973363..2982273 0.004 View NZ_LR882499 Mycobacterium tuberculosis variant microti OV254 isolate vole Prophage TA289887 2966634..2975547 0.004 View NZ_LR882500 Mycobacterium tuberculosis variant microti strain 94-2272 isolate human Prophage TA289947 2975414..2984324 0.004 View NZ_OW052189 Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis Prophage TA295147 395877..404786 0.003 View NZ_OW052302 Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis Prophage TA295251 3771825..3780734 0.003 View NZ_OW052571 Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis Prophage TA295332 1385754..1394663 0.003	inside	Prophage	-	-	2970551..2980818	10267

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 108 a.a.
• Molecular weight: 12359.82 Da
• Isoelectric Point: 8.6717

>T120 NP_217169.1 NC_000962:c2976909-2976586 [Mycobacterium tuberculosis H37Rv]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Nucleotide

• Length: 324 bp

>T120 NC_000962:c2976909-2976586 [Mycobacterium tuberculosis H37Rv]
TTGACCCACAAGCGCACTAAACGCCAGCCAGCCATCGCCGCAGGGCTCAACGCCCCGCGTCGGAATCGCGTTGGGCGGCA
ACATGGTTGGCCGGCCGACGTTCCGTCCGCCGAGCAGCGCCGCGCCCAACGGCAGCGCGACCTCGAGGCTATCCGCCGAG
CGTACGCCGAGATGGTGGCGACATCACACGAAATCGACGACGACACAGCCGAACTGGCGCTGTTGTCGATGCATCTCGAC
GATGAGCAGCGCCGGCTTGAGGCGGGGATGAAGCTCGGCTGGCATCCGTATCACTTCCCCGACGAACCCGACAGCAAACA
GTGA

Antitoxin

Protein

• Length: 82 a.a.
• Molecular weight: 7697.71 Da
• Isoelectric Point: 4.8565

>AT120 NP_217170.1 NC_000962:c2977234-2976989 [Mycobacterium tuberculosis H37Rv]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Nucleotide

• Length: 246 bp

>AT120 NC_000962:c2977234-2976989 [Mycobacterium tuberculosis H37Rv]
ATGAGCGGCCACGCGTTGGCTGCTCGGACGTTGCTGGCCGCCGCGGACGAGCTTGTCGGCGGCCCGCCAGTCGAGGCTTC
GGCCGCCGCGCTGGCCGGCGACGCCGCGGGCGCATGGCGGACCGCGGCCGTCGAGCTTGCGCGAGCGTTGGTCCGCGCTG
TGGCGGAGTCGCACGGCGTCGCGGCCGTTTTGTTCGCCGCGACGGCCGCCGCGGCGGCGGCCGTCGACCGGGGTGATCCG
CCGTGA

Structures

Toxin

• AlphaFold DB: P9WJ13

Antitoxin

• AlphaFold DB: P9WJ11

References

(1) Holly R Ramage et al. (2009) Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genetics 5(12):e1000767. [PubMed:20011113]


 experimental literature