289827

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2978038..2978686 Replicon chromosome
Accession NZ_LR882498
Organism Mycobacterium tuberculosis variant microti strain Maus III isolate human

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID A0A7U8TVG5
Locus tag JN980_RS13815 Protein ID WP_003909715.1
Coordinates 2978038..2978361 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag JN980_RS13820 Protein ID WP_003899415.1
Coordinates 2978441..2978686 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN980_RS13785 2973363..2974361 + 999 WP_105799867.1 tyrosine-type recombinase/integrase -
JN980_RS13790 2974375..2974839 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
JN980_RS13795 2974827..2975078 + 252 WP_003908028.1 hypothetical protein -
JN980_RS13800 2975249..2976686 - 1438 Protein_2719 phage major capsid protein -
JN980_RS13805 2976694..2977227 - 534 WP_003899412.1 HK97 family phage prohead protease -
JN980_RS13810 2977380..2977871 - 492 WP_003900541.1 phage terminase small subunit P27 family -
JN980_RS13815 2978038..2978361 - 324 WP_003909715.1 type II toxin-antitoxin system toxin Toxin
JN980_RS13820 2978441..2978686 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
JN980_RS13825 2978683..2980113 - 1431 WP_202582051.1 DUF3631 domain-containing protein -
JN980_RS13830 2980115..2980507 - 393 WP_003899417.1 DUF2742 domain-containing protein -
JN980_RS13835 2980504..2980764 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
JN980_RS13840 2980781..2981143 - 363 WP_003900543.1 hypothetical protein -
JN980_RS13845 2981146..2982273 - 1128 WP_003899420.1 site-specific integrase -
JN980_RS13850 2982418..2982645 - 228 WP_003899421.1 hypothetical protein -
JN980_RS13855 2982642..2983031 - 390 WP_003899422.1 hypothetical protein -
JN980_RS13860 2982937..2983209 + 273 WP_003900544.1 hypothetical protein -
JN980_RS13865 2983308..2983541 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2973363..2982273 8910


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.81 Da        Isoelectric Point: 8.6568

>T289827 WP_003909715.1 NZ_LR882498:c2978361-2978038 [Mycobacterium tuberculosis variant microti]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT289827 WP_003899415.1 NZ_LR882498:c2978686-2978441 [Mycobacterium tuberculosis variant microti]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U8TVG5

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References