Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2980225..2980873 Replicon chromosome
Accession NZ_CP110619
Organism Mycobacterium tuberculosis strain H37Rv-1

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag M7V54_RS14100 Protein ID WP_003899414.1
Coordinates 2980225..2980548 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag M7V54_RS14105 Protein ID WP_003899415.1
Coordinates 2980628..2980873 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7V54_RS14080 2975799..2977060 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -
M7V54_RS14085 2977434..2978873 - 1440 WP_009935349.1 phage major capsid protein -
M7V54_RS14090 2978881..2979414 - 534 WP_003899412.1 HK97 family phage prohead protease -
M7V54_RS14095 2979567..2980058 - 492 WP_003900541.1 phage terminase small subunit P27 family -
M7V54_RS14100 2980225..2980548 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
M7V54_RS14105 2980628..2980873 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
M7V54_RS14110 2980870..2982297 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
M7V54_RS14115 2982299..2982691 - 393 WP_003899417.1 DUF2742 domain-containing protein -
M7V54_RS14120 2982688..2982948 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
M7V54_RS14125 2982965..2983327 - 363 WP_003900543.1 hypothetical protein -
M7V54_RS14130 2983330..2984457 - 1128 WP_003899420.1 site-specific integrase -
M7V54_RS14135 2984602..2984829 - 228 WP_003899421.1 hypothetical protein -
M7V54_RS14140 2984826..2985215 - 390 WP_003899422.1 hypothetical protein -
M7V54_RS14145 2985121..2985393 + 273 WP_003900544.1 hypothetical protein -
M7V54_RS14150 2985492..2985725 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2974190..2984457 10267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T264014 WP_003899414.1 NZ_CP110619:c2980548-2980225 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT264014 WP_003899415.1 NZ_CP110619:c2980873-2980628 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References