Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2980569..2981217 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID A0A7U8TVG5
Locus tag JN995_RS13845 Protein ID WP_003909715.1
Coordinates 2980569..2980892 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag JN995_RS13850 Protein ID WP_003899415.1
Coordinates 2980972..2981217 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS13815 2975894..2976892 + 999 WP_105799867.1 tyrosine-type recombinase/integrase -
JN995_RS13820 2976906..2977370 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
JN995_RS13825 2977358..2977609 + 252 WP_003908028.1 hypothetical protein -
JN995_RS13830 2977780..2979217 - 1438 Protein_2726 phage major capsid protein -
JN995_RS13835 2979225..2979758 - 534 WP_003899412.1 HK97 family phage prohead protease -
JN995_RS13840 2979911..2980402 - 492 WP_003900541.1 phage terminase small subunit P27 family -
JN995_RS13845 2980569..2980892 - 324 WP_003909715.1 type II toxin-antitoxin system toxin Toxin
JN995_RS13850 2980972..2981217 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
JN995_RS13855 2981214..2982647 - 1434 WP_105799846.1 DUF3631 domain-containing protein -
JN995_RS13860 2982649..2983041 - 393 WP_003899417.1 DUF2742 domain-containing protein -
JN995_RS13865 2983038..2983298 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
JN995_RS13870 2983315..2983677 - 363 WP_003900543.1 hypothetical protein -
JN995_RS13875 2983680..2984807 - 1128 WP_003899420.1 site-specific integrase -
JN995_RS13880 2984952..2985179 - 228 WP_003899421.1 hypothetical protein -
JN995_RS13885 2985176..2985565 - 390 WP_003899422.1 hypothetical protein -
JN995_RS13890 2985471..2985743 + 273 WP_003900544.1 hypothetical protein -
JN995_RS13895 2985842..2986075 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2973867..2984807 10940


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.81 Da        Isoelectric Point: 8.6568

>T289767 WP_003909715.1 NZ_LR882497:c2980892-2980569 [Mycobacterium tuberculosis variant microti]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT289767 WP_003899415.1 NZ_LR882497:c2981217-2980972 [Mycobacterium tuberculosis variant microti]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U8TVG5

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References