Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2961394..2962042 Replicon chromosome
Accession NZ_CP127276
Organism Mycobacterium tuberculosis strain 5521

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag QRF08_RS14005 Protein ID WP_003899414.1
Coordinates 2961394..2961717 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag QRF08_RS14010 Protein ID WP_003899415.1
Coordinates 2961797..2962042 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF08_RS13985 (QRF08_13985) 2956968..2958229 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -
QRF08_RS13990 (QRF08_13990) 2958603..2960042 - 1440 WP_003901443.1 phage major capsid protein -
QRF08_RS13995 (QRF08_13995) 2960050..2960583 - 534 WP_003899412.1 HK97 family phage prohead protease -
QRF08_RS14000 (QRF08_14000) 2960736..2961227 - 492 WP_003900541.1 phage terminase small subunit P27 family -
QRF08_RS14005 (QRF08_14005) 2961394..2961717 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
QRF08_RS14010 (QRF08_14010) 2961797..2962042 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
QRF08_RS14015 (QRF08_14015) 2962039..2963466 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
QRF08_RS14020 (QRF08_14020) 2963468..2963860 - 393 WP_003899417.1 DUF2742 domain-containing protein -
QRF08_RS14025 (QRF08_14025) 2963857..2964117 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
QRF08_RS14030 (QRF08_14030) 2964134..2964496 - 363 WP_003900543.1 hypothetical protein -
QRF08_RS14035 (QRF08_14035) 2964499..2965626 - 1128 WP_003899420.1 site-specific integrase -
QRF08_RS14040 (QRF08_14040) 2965771..2965998 - 228 WP_003899421.1 hypothetical protein -
QRF08_RS14045 (QRF08_14045) 2965995..2966384 - 390 WP_003899422.1 hypothetical protein -
QRF08_RS14050 (QRF08_14050) 2966290..2966562 + 273 WP_003900544.1 hypothetical protein -
QRF08_RS14055 (QRF08_14055) 2966661..2966894 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2955359..2965626 10267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T283976 WP_003899414.1 NZ_CP127276:c2961717-2961394 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT283976 WP_003899415.1 NZ_CP127276:c2962042-2961797 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References