Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2960520..2961168 Replicon chromosome
Accession NZ_CP127274
Organism Mycobacterium tuberculosis strain 17221

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag QRF10_RS13990 Protein ID WP_003899414.1
Coordinates 2960520..2960843 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag QRF10_RS13995 Protein ID WP_003899415.1
Coordinates 2960923..2961168 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF10_RS13970 (QRF10_13970) 2956094..2957355 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -
QRF10_RS13975 (QRF10_13975) 2957729..2959168 - 1440 WP_003899411.1 phage major capsid protein -
QRF10_RS13980 (QRF10_13980) 2959176..2959709 - 534 WP_003899412.1 HK97 family phage prohead protease -
QRF10_RS13985 (QRF10_13985) 2959862..2960353 - 492 WP_003900541.1 phage terminase small subunit P27 family -
QRF10_RS13990 (QRF10_13990) 2960520..2960843 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
QRF10_RS13995 (QRF10_13995) 2960923..2961168 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
QRF10_RS14000 (QRF10_14000) 2961165..2962592 - 1428 WP_003912825.1 DUF3631 domain-containing protein -
QRF10_RS14005 (QRF10_14005) 2962594..2962986 - 393 WP_003899417.1 DUF2742 domain-containing protein -
QRF10_RS14010 (QRF10_14010) 2962983..2963243 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
QRF10_RS14015 (QRF10_14015) 2963260..2963622 - 363 WP_003900543.1 hypothetical protein -
QRF10_RS14020 (QRF10_14020) 2963625..2964752 - 1128 WP_003899420.1 site-specific integrase -
QRF10_RS14025 (QRF10_14025) 2964897..2965124 - 228 WP_003899421.1 hypothetical protein -
QRF10_RS14030 (QRF10_14030) 2965121..2965510 - 390 WP_003899422.1 hypothetical protein -
QRF10_RS14035 (QRF10_14035) 2965416..2965688 + 273 WP_003900544.1 hypothetical protein -
QRF10_RS14040 (QRF10_14040) 2965787..2966020 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2954485..2964752 10267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T283854 WP_003899414.1 NZ_CP127274:c2960843-2960520 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT283854 WP_003899415.1 NZ_CP127274:c2961168-2960923 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References