Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2749704..2750352 Replicon chromosome
Accession NZ_CP110674
Organism Mycobacterium tuberculosis strain BLR-31d

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag OO115_RS12785 Protein ID WP_003899414.1
Coordinates 2749704..2750027 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag OO115_RS12790 Protein ID WP_003899415.1
Coordinates 2750107..2750352 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO115_RS12755 (OO115_12755) 2745027..2746025 + 999 WP_003900538.1 tyrosine-type recombinase/integrase -
OO115_RS12760 (OO115_12760) 2746039..2746503 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
OO115_RS12765 (OO115_12765) 2746491..2746742 + 252 WP_003908028.1 hypothetical protein -
OO115_RS12770 (OO115_12770) 2746913..2748352 - 1440 WP_003901443.1 phage major capsid protein -
OO115_RS12775 (OO115_12775) 2748360..2748893 - 534 WP_003899412.1 HK97 family phage prohead protease -
OO115_RS12780 (OO115_12780) 2749046..2749537 - 492 WP_003900541.1 phage terminase small subunit P27 family -
OO115_RS12785 (OO115_12785) 2749704..2750027 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
OO115_RS12790 (OO115_12790) 2750107..2750352 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
OO115_RS12795 (OO115_12795) 2750349..2751776 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
OO115_RS12800 (OO115_12800) 2751778..2752170 - 393 WP_003899417.1 DUF2742 domain-containing protein -
OO115_RS12805 (OO115_12805) 2752167..2752427 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
OO115_RS12810 (OO115_12810) 2752444..2752806 - 363 WP_003900543.1 hypothetical protein -
OO115_RS12815 (OO115_12815) 2752809..2753936 - 1128 WP_003899420.1 site-specific integrase -
OO115_RS12820 (OO115_12820) 2754081..2754308 - 228 WP_003899421.1 hypothetical protein -
OO115_RS12825 (OO115_12825) 2754305..2754694 - 390 WP_003899422.1 hypothetical protein -
OO115_RS12830 (OO115_12830) 2754600..2754872 + 273 WP_003900544.1 hypothetical protein -
OO115_RS12835 (OO115_12835) 2754971..2755204 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2745027..2757023 11996


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T264166 WP_003899414.1 NZ_CP110674:c2750027-2749704 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT264166 WP_003899415.1 NZ_CP110674:c2750352-2750107 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References