Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | unclassified/- |
Location | 2960024..2960672 | Replicon | chromosome |
Accession | NZ_CP125620 | ||
Organism | Mycobacterium tuberculosis strain BLR 4299 2019 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | P9WJ12 |
Locus tag | O3Q54_RS13975 | Protein ID | WP_003899414.1 |
Coordinates | 2960024..2960347 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ10 |
Locus tag | O3Q54_RS13980 | Protein ID | WP_003899415.1 |
Coordinates | 2960427..2960672 (-) | Length | 82 a.a. |
Genomic Context
Location: 2955347..2956345 (999 bp)
Type: Others
Protein ID: WP_003900538.1
Type: Others
Protein ID: WP_003900538.1
Location: 2956359..2956823 (465 bp)
Type: Others
Protein ID: WP_003900539.1
Type: Others
Protein ID: WP_003900539.1
Location: 2956811..2957062 (252 bp)
Type: Others
Protein ID: WP_003908028.1
Type: Others
Protein ID: WP_003908028.1
Location: 2964920..2965192 (273 bp)
Type: Others
Protein ID: WP_003900544.1
Type: Others
Protein ID: WP_003900544.1
Location: 2965291..2965524 (234 bp)
Type: Others
Protein ID: WP_003413717.1
Type: Others
Protein ID: WP_003413717.1
Location: 2957233..2958672 (1440 bp)
Type: Others
Protein ID: WP_003899411.1
Type: Others
Protein ID: WP_003899411.1
Location: 2958680..2959213 (534 bp)
Type: Others
Protein ID: WP_003899412.1
Type: Others
Protein ID: WP_003899412.1
Location: 2959366..2959857 (492 bp)
Type: Others
Protein ID: WP_003900541.1
Type: Others
Protein ID: WP_003900541.1
Location: 2960024..2960347 (324 bp)
Type: Toxin
Protein ID: WP_003899414.1
Type: Toxin
Protein ID: WP_003899414.1
Location: 2960427..2960672 (246 bp)
Type: Antitoxin
Protein ID: WP_003899415.1
Type: Antitoxin
Protein ID: WP_003899415.1
Location: 2960669..2962096 (1428 bp)
Type: Others
Protein ID: WP_003899416.1
Type: Others
Protein ID: WP_003899416.1
Location: 2962098..2962490 (393 bp)
Type: Others
Protein ID: WP_003899417.1
Type: Others
Protein ID: WP_003899417.1
Location: 2962487..2962747 (261 bp)
Type: Others
Protein ID: WP_014585547.1
Type: Others
Protein ID: WP_014585547.1
Location: 2962764..2963126 (363 bp)
Type: Others
Protein ID: WP_003900543.1
Type: Others
Protein ID: WP_003900543.1
Location: 2963129..2964256 (1128 bp)
Type: Others
Protein ID: WP_003899420.1
Type: Others
Protein ID: WP_003899420.1
Location: 2964401..2964628 (228 bp)
Type: Others
Protein ID: WP_003899421.1
Type: Others
Protein ID: WP_003899421.1
Location: 2964625..2965014 (390 bp)
Type: Others
Protein ID: WP_003899422.1
Type: Others
Protein ID: WP_003899422.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3Q54_RS13945 (O3Q54_13945) | 2955347..2956345 | + | 999 | WP_003900538.1 | tyrosine-type recombinase/integrase | - |
O3Q54_RS13950 (O3Q54_13950) | 2956359..2956823 | + | 465 | WP_003900539.1 | ParB N-terminal domain-containing protein | - |
O3Q54_RS13955 (O3Q54_13955) | 2956811..2957062 | + | 252 | WP_003908028.1 | hypothetical protein | - |
O3Q54_RS13960 (O3Q54_13960) | 2957233..2958672 | - | 1440 | WP_003899411.1 | phage major capsid protein | - |
O3Q54_RS13965 (O3Q54_13965) | 2958680..2959213 | - | 534 | WP_003899412.1 | HK97 family phage prohead protease | - |
O3Q54_RS13970 (O3Q54_13970) | 2959366..2959857 | - | 492 | WP_003900541.1 | phage terminase small subunit P27 family | - |
O3Q54_RS13975 (O3Q54_13975) | 2960024..2960347 | - | 324 | WP_003899414.1 | type II toxin-antitoxin system toxin | Toxin |
O3Q54_RS13980 (O3Q54_13980) | 2960427..2960672 | - | 246 | WP_003899415.1 | type II toxin-antitoxin system antitoxin | Antitoxin |
O3Q54_RS13985 (O3Q54_13985) | 2960669..2962096 | - | 1428 | WP_003899416.1 | DUF3631 domain-containing protein | - |
O3Q54_RS13990 (O3Q54_13990) | 2962098..2962490 | - | 393 | WP_003899417.1 | DUF2742 domain-containing protein | - |
O3Q54_RS13995 (O3Q54_13995) | 2962487..2962747 | - | 261 | WP_014585547.1 | helix-turn-helix domain-containing protein | - |
O3Q54_RS14000 (O3Q54_14000) | 2962764..2963126 | - | 363 | WP_003900543.1 | hypothetical protein | - |
O3Q54_RS14005 (O3Q54_14005) | 2963129..2964256 | - | 1128 | WP_003899420.1 | site-specific integrase | - |
O3Q54_RS14010 (O3Q54_14010) | 2964401..2964628 | - | 228 | WP_003899421.1 | hypothetical protein | - |
O3Q54_RS14015 (O3Q54_14015) | 2964625..2965014 | - | 390 | WP_003899422.1 | hypothetical protein | - |
O3Q54_RS14020 (O3Q54_14020) | 2964920..2965192 | + | 273 | WP_003900544.1 | hypothetical protein | - |
O3Q54_RS14025 (O3Q54_14025) | 2965291..2965524 | + | 234 | WP_003413717.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2955347..2964256 | 8909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12359.82 Da Isoelectric Point: 8.6717
>T282209 WP_003899414.1 NZ_CP125620:c2960347-2960024 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
Download Length: 324 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A045IHC4 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JR81 |