Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2960024..2960672 Replicon chromosome
Accession NZ_CP125620
Organism Mycobacterium tuberculosis strain BLR 4299 2019

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag O3Q54_RS13975 Protein ID WP_003899414.1
Coordinates 2960024..2960347 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag O3Q54_RS13980 Protein ID WP_003899415.1
Coordinates 2960427..2960672 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3Q54_RS13945 (O3Q54_13945) 2955347..2956345 + 999 WP_003900538.1 tyrosine-type recombinase/integrase -
O3Q54_RS13950 (O3Q54_13950) 2956359..2956823 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
O3Q54_RS13955 (O3Q54_13955) 2956811..2957062 + 252 WP_003908028.1 hypothetical protein -
O3Q54_RS13960 (O3Q54_13960) 2957233..2958672 - 1440 WP_003899411.1 phage major capsid protein -
O3Q54_RS13965 (O3Q54_13965) 2958680..2959213 - 534 WP_003899412.1 HK97 family phage prohead protease -
O3Q54_RS13970 (O3Q54_13970) 2959366..2959857 - 492 WP_003900541.1 phage terminase small subunit P27 family -
O3Q54_RS13975 (O3Q54_13975) 2960024..2960347 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
O3Q54_RS13980 (O3Q54_13980) 2960427..2960672 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
O3Q54_RS13985 (O3Q54_13985) 2960669..2962096 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
O3Q54_RS13990 (O3Q54_13990) 2962098..2962490 - 393 WP_003899417.1 DUF2742 domain-containing protein -
O3Q54_RS13995 (O3Q54_13995) 2962487..2962747 - 261 WP_014585547.1 helix-turn-helix domain-containing protein -
O3Q54_RS14000 (O3Q54_14000) 2962764..2963126 - 363 WP_003900543.1 hypothetical protein -
O3Q54_RS14005 (O3Q54_14005) 2963129..2964256 - 1128 WP_003899420.1 site-specific integrase -
O3Q54_RS14010 (O3Q54_14010) 2964401..2964628 - 228 WP_003899421.1 hypothetical protein -
O3Q54_RS14015 (O3Q54_14015) 2964625..2965014 - 390 WP_003899422.1 hypothetical protein -
O3Q54_RS14020 (O3Q54_14020) 2964920..2965192 + 273 WP_003900544.1 hypothetical protein -
O3Q54_RS14025 (O3Q54_14025) 2965291..2965524 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2955347..2964256 8909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T282209 WP_003899414.1 NZ_CP125620:c2960347-2960024 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT282209 WP_003899415.1 NZ_CP125620:c2960672-2960427 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References