Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2971309..2971957 Replicon chromosome
Accession NZ_LR882499
Organism Mycobacterium tuberculosis variant microti OV254 isolate vole

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID A0A7U8TVG5
Locus tag JN986_RS13785 Protein ID WP_003909715.1
Coordinates 2971309..2971632 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag JN986_RS13790 Protein ID WP_003899415.1
Coordinates 2971712..2971957 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN986_RS13755 2966634..2967632 + 999 WP_105799867.1 tyrosine-type recombinase/integrase -
JN986_RS13760 2967646..2968110 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
JN986_RS13765 2968098..2968349 + 252 WP_003908028.1 hypothetical protein -
JN986_RS13770 2968520..2969957 - 1438 Protein_2715 phage major capsid protein -
JN986_RS13775 2969965..2970498 - 534 WP_003899412.1 HK97 family phage prohead protease -
JN986_RS13780 2970651..2971142 - 492 WP_003900541.1 phage terminase small subunit P27 family -
JN986_RS13785 2971309..2971632 - 324 WP_003909715.1 type II toxin-antitoxin system toxin Toxin
JN986_RS13790 2971712..2971957 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
JN986_RS13795 2971954..2973387 - 1434 WP_105799846.1 DUF3631 domain-containing protein -
JN986_RS13800 2973389..2973781 - 393 WP_003899417.1 DUF2742 domain-containing protein -
JN986_RS13805 2973778..2974038 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
JN986_RS13810 2974055..2974417 - 363 WP_003900543.1 hypothetical protein -
JN986_RS13815 2974420..2975547 - 1128 WP_003899420.1 site-specific integrase -
JN986_RS13820 2975692..2975919 - 228 WP_003899421.1 hypothetical protein -
JN986_RS13825 2975916..2976305 - 390 WP_003899422.1 hypothetical protein -
JN986_RS13830 2976211..2976483 + 273 WP_003900544.1 hypothetical protein -
JN986_RS13835 2976582..2976815 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2966634..2975547 8913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.81 Da        Isoelectric Point: 8.6568

>T289887 WP_003909715.1 NZ_LR882499:c2971632-2971309 [Mycobacterium tuberculosis variant microti OV254]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT289887 WP_003899415.1 NZ_LR882499:c2971957-2971712 [Mycobacterium tuberculosis variant microti OV254]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U8TVG5

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References