Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2980089..2980737 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID A0A7U8TVG5
Locus tag JOA04_RS13835 Protein ID WP_003909715.1
Coordinates 2980089..2980412 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag JOA04_RS13840 Protein ID WP_003899415.1
Coordinates 2980492..2980737 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS13805 2975414..2976412 + 999 WP_105799867.1 tyrosine-type recombinase/integrase -
JOA04_RS13810 2976426..2976890 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
JOA04_RS13815 2976878..2977129 + 252 WP_003908028.1 hypothetical protein -
JOA04_RS13820 2977300..2978737 - 1438 Protein_2726 phage major capsid protein -
JOA04_RS13825 2978745..2979278 - 534 WP_003899412.1 HK97 family phage prohead protease -
JOA04_RS13830 2979431..2979922 - 492 WP_003900541.1 phage terminase small subunit P27 family -
JOA04_RS13835 2980089..2980412 - 324 WP_003909715.1 type II toxin-antitoxin system toxin Toxin
JOA04_RS13840 2980492..2980737 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
JOA04_RS13845 2980734..2982164 - 1431 WP_202582051.1 DUF3631 domain-containing protein -
JOA04_RS13850 2982166..2982558 - 393 WP_003899417.1 DUF2742 domain-containing protein -
JOA04_RS13855 2982555..2982815 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
JOA04_RS13860 2982832..2983194 - 363 WP_003900543.1 hypothetical protein -
JOA04_RS13865 2983197..2984324 - 1128 WP_202586493.1 site-specific integrase -
JOA04_RS13870 2984469..2984696 - 228 WP_003899421.1 hypothetical protein -
JOA04_RS13875 2984693..2985082 - 390 WP_003899422.1 hypothetical protein -
JOA04_RS13880 2984988..2985260 + 273 WP_003900544.1 hypothetical protein -
JOA04_RS13885 2985359..2985592 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2975414..2984324 8910


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.81 Da        Isoelectric Point: 8.6568

>T289947 WP_003909715.1 NZ_LR882500:c2980412-2980089 [Mycobacterium tuberculosis variant microti]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT289947 WP_003899415.1 NZ_LR882500:c2980737-2980492 [Mycobacterium tuberculosis variant microti]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U8TVG5

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References