Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/- |
| Location | 2980089..2980737 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | A0A7U8TVG5 |
| Locus tag | JOA04_RS13835 | Protein ID | WP_003909715.1 |
| Coordinates | 2980089..2980412 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | P9WJ10 |
| Locus tag | JOA04_RS13840 | Protein ID | WP_003899415.1 |
| Coordinates | 2980492..2980737 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS13805 | 2975414..2976412 | + | 999 | WP_105799867.1 | tyrosine-type recombinase/integrase | - |
| JOA04_RS13810 | 2976426..2976890 | + | 465 | WP_003900539.1 | ParB N-terminal domain-containing protein | - |
| JOA04_RS13815 | 2976878..2977129 | + | 252 | WP_003908028.1 | hypothetical protein | - |
| JOA04_RS13820 | 2977300..2978737 | - | 1438 | Protein_2726 | phage major capsid protein | - |
| JOA04_RS13825 | 2978745..2979278 | - | 534 | WP_003899412.1 | HK97 family phage prohead protease | - |
| JOA04_RS13830 | 2979431..2979922 | - | 492 | WP_003900541.1 | phage terminase small subunit P27 family | - |
| JOA04_RS13835 | 2980089..2980412 | - | 324 | WP_003909715.1 | type II toxin-antitoxin system toxin | Toxin |
| JOA04_RS13840 | 2980492..2980737 | - | 246 | WP_003899415.1 | type II toxin-antitoxin system antitoxin | Antitoxin |
| JOA04_RS13845 | 2980734..2982164 | - | 1431 | WP_202582051.1 | DUF3631 domain-containing protein | - |
| JOA04_RS13850 | 2982166..2982558 | - | 393 | WP_003899417.1 | DUF2742 domain-containing protein | - |
| JOA04_RS13855 | 2982555..2982815 | - | 261 | WP_003899418.1 | helix-turn-helix domain-containing protein | - |
| JOA04_RS13860 | 2982832..2983194 | - | 363 | WP_003900543.1 | hypothetical protein | - |
| JOA04_RS13865 | 2983197..2984324 | - | 1128 | WP_202586493.1 | site-specific integrase | - |
| JOA04_RS13870 | 2984469..2984696 | - | 228 | WP_003899421.1 | hypothetical protein | - |
| JOA04_RS13875 | 2984693..2985082 | - | 390 | WP_003899422.1 | hypothetical protein | - |
| JOA04_RS13880 | 2984988..2985260 | + | 273 | WP_003900544.1 | hypothetical protein | - |
| JOA04_RS13885 | 2985359..2985592 | + | 234 | WP_003413717.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2975414..2984324 | 8910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.81 Da Isoelectric Point: 8.6568
>T289947 WP_003909715.1 NZ_LR882500:c2980412-2980089 [Mycobacterium tuberculosis variant microti]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U8TVG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A806JR81 |