Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/- |
| Location | 3775409..3776057 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | P9WJ12 |
| Locus tag | MR176_RS17525 | Protein ID | WP_003899414.1 |
| Coordinates | 3775734..3776057 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | P9WJ10 |
| Locus tag | MR176_RS17520 | Protein ID | WP_003899415.1 |
| Coordinates | 3775409..3775654 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS17475 | 3770557..3770790 | - | 234 | WP_003413717.1 | hypothetical protein | - |
| MR176_RS17480 | 3770889..3771161 | - | 273 | WP_003900544.1 | hypothetical protein | - |
| MR176_RS17485 | 3771067..3771456 | + | 390 | WP_003899422.1 | hypothetical protein | - |
| MR176_RS17490 | 3771453..3771680 | + | 228 | WP_003899421.1 | hypothetical protein | - |
| MR176_RS17495 | 3771825..3772952 | + | 1128 | WP_003899420.1 | site-specific integrase | - |
| MR176_RS17500 | 3772955..3773317 | + | 363 | WP_003900543.1 | hypothetical protein | - |
| MR176_RS17505 | 3773334..3773594 | + | 261 | WP_003899418.1 | helix-turn-helix domain-containing protein | - |
| MR176_RS17510 | 3773591..3773983 | + | 393 | WP_003899417.1 | DUF2742 domain-containing protein | - |
| MR176_RS17515 | 3773985..3775412 | + | 1428 | WP_003899416.1 | DUF3631 domain-containing protein | - |
| MR176_RS17520 | 3775409..3775654 | + | 246 | WP_003899415.1 | type II toxin-antitoxin system antitoxin | Antitoxin |
| MR176_RS17525 | 3775734..3776057 | + | 324 | WP_003899414.1 | type II toxin-antitoxin system toxin | Toxin |
| MR176_RS17530 | 3776224..3776715 | + | 492 | WP_003900541.1 | phage terminase small subunit P27 family | - |
| MR176_RS17535 | 3776868..3777401 | + | 534 | WP_003899412.1 | HK97 family phage prohead protease | - |
| MR176_RS17540 | 3777409..3778848 | + | 1440 | WP_003901443.1 | phage major capsid protein | - |
| MR176_RS17545 | 3779019..3779270 | - | 252 | WP_003908028.1 | hypothetical protein | - |
| MR176_RS17550 | 3779258..3779722 | - | 465 | WP_003900539.1 | ParB N-terminal domain-containing protein | - |
| MR176_RS17555 | 3779736..3780734 | - | 999 | WP_003900538.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3771825..3780734 | 8909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12359.82 Da Isoelectric Point: 8.6717
>T295251 WP_003899414.1 NZ_OW052302:3775734-3776057 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A045IHC4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A806JR81 |