Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 3775409..3776057 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag MR176_RS17525 Protein ID WP_003899414.1
Coordinates 3775734..3776057 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag MR176_RS17520 Protein ID WP_003899415.1
Coordinates 3775409..3775654 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS17475 3770557..3770790 - 234 WP_003413717.1 hypothetical protein -
MR176_RS17480 3770889..3771161 - 273 WP_003900544.1 hypothetical protein -
MR176_RS17485 3771067..3771456 + 390 WP_003899422.1 hypothetical protein -
MR176_RS17490 3771453..3771680 + 228 WP_003899421.1 hypothetical protein -
MR176_RS17495 3771825..3772952 + 1128 WP_003899420.1 site-specific integrase -
MR176_RS17500 3772955..3773317 + 363 WP_003900543.1 hypothetical protein -
MR176_RS17505 3773334..3773594 + 261 WP_003899418.1 helix-turn-helix domain-containing protein -
MR176_RS17510 3773591..3773983 + 393 WP_003899417.1 DUF2742 domain-containing protein -
MR176_RS17515 3773985..3775412 + 1428 WP_003899416.1 DUF3631 domain-containing protein -
MR176_RS17520 3775409..3775654 + 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
MR176_RS17525 3775734..3776057 + 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
MR176_RS17530 3776224..3776715 + 492 WP_003900541.1 phage terminase small subunit P27 family -
MR176_RS17535 3776868..3777401 + 534 WP_003899412.1 HK97 family phage prohead protease -
MR176_RS17540 3777409..3778848 + 1440 WP_003901443.1 phage major capsid protein -
MR176_RS17545 3779019..3779270 - 252 WP_003908028.1 hypothetical protein -
MR176_RS17550 3779258..3779722 - 465 WP_003900539.1 ParB N-terminal domain-containing protein -
MR176_RS17555 3779736..3780734 - 999 WP_003900538.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3771825..3780734 8909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T295251 WP_003899414.1 NZ_OW052302:3775734-3776057 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT295251 WP_003899415.1 NZ_OW052302:3775409-3775654 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References