295147

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 400554..401202 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag MR259_RS01920 Protein ID WP_003899414.1
Coordinates 400554..400877 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag MR259_RS01925 Protein ID WP_003899415.1
Coordinates 400957..401202 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS01890 395877..396875 + 999 WP_003900538.1 tyrosine-type recombinase/integrase -
MR259_RS01895 396889..397353 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
MR259_RS01900 397341..397592 + 252 WP_003908028.1 hypothetical protein -
MR259_RS01905 397763..399202 - 1440 WP_003901443.1 phage major capsid protein -
MR259_RS01910 399210..399743 - 534 WP_003899412.1 HK97 family phage prohead protease -
MR259_RS01915 399896..400387 - 492 WP_003900541.1 phage terminase small subunit P27 family -
MR259_RS01920 400554..400877 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
MR259_RS01925 400957..401202 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
MR259_RS01930 401199..402626 - 1428 WP_242382551.1 DUF3631 domain-containing protein -
MR259_RS01935 402628..403020 - 393 WP_003899417.1 DUF2742 domain-containing protein -
MR259_RS01940 403017..403277 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
MR259_RS01945 403294..403656 - 363 WP_003900543.1 hypothetical protein -
MR259_RS01950 403659..404786 - 1128 WP_003899420.1 site-specific integrase -
MR259_RS01955 404931..405158 - 228 WP_003899421.1 hypothetical protein -
MR259_RS01960 405155..405544 - 390 WP_242382552.1 hypothetical protein -
MR259_RS01965 405450..405722 + 273 WP_003900544.1 hypothetical protein -
MR259_RS01970 405821..406054 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 395877..404786 8909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T295147 WP_003899414.1 NZ_OW052189:c400877-400554 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT295147 WP_003899415.1 NZ_OW052189:c401202-400957 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References