Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2970659..2971307 Replicon chromosome
Accession NZ_HG813240
Organism Mycobacterium tuberculosis 49-02

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag MT49_RS14015 Protein ID WP_003899414.1
Coordinates 2970659..2970982 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag MT49_RS14020 Protein ID WP_003899415.1
Coordinates 2971062..2971307 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MT49_RS13985 2965981..2966979 + 999 WP_003900538.1 tyrosine-type recombinase/integrase -
MT49_RS13990 2966993..2967457 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
MT49_RS13995 2967445..2967696 + 252 WP_003908028.1 hypothetical protein -
MT49_RS14000 2967867..2969306 - 1440 WP_003901443.1 phage major capsid protein -
MT49_RS14005 2969314..2969847 - 534 WP_003899412.1 HK97 family phage prohead protease -
MT49_RS21600 2970000..2970491 - 492 WP_003900541.1 phage terminase small subunit P27 family -
MT49_RS14015 2970659..2970982 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
MT49_RS14020 2971062..2971307 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
MT49_RS14025 2971304..2972731 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
MT49_RS14030 2972733..2973125 - 393 WP_003899417.1 DUF2742 domain-containing protein -
MT49_RS14035 2973122..2973382 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
MT49_RS14040 2973399..2973761 - 363 WP_003900543.1 hypothetical protein -
MT49_RS14045 2973764..2974891 - 1128 WP_003899420.1 site-specific integrase -
MT49_RS14050 2975036..2975263 - 228 WP_003899421.1 hypothetical protein -
MT49_RS21605 2975260..2975649 - 390 WP_003899422.1 hypothetical protein -
MT49_RS14055 2975555..2975827 + 273 WP_003900544.1 hypothetical protein -
MT49_RS14060 2975926..2976159 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2965981..2974891 8910


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T285100 WP_003899414.1 NZ_HG813240:c2970982-2970659 [Mycobacterium tuberculosis 49-02]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT285100 WP_003899415.1 NZ_HG813240:c2971307-2971062 [Mycobacterium tuberculosis 49-02]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References