Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/- |
| Location | 2967312..2967960 | Replicon | chromosome |
| Accession | NZ_LR882496 | ||
| Organism | Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | A0A7U8TVG5 |
| Locus tag | JN993_RS13775 | Protein ID | WP_003909715.1 |
| Coordinates | 2967312..2967635 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | P9WJ10 |
| Locus tag | JN993_RS13780 | Protein ID | WP_003899415.1 |
| Coordinates | 2967715..2967960 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN993_RS13745 | 2962637..2963635 | + | 999 | WP_105799867.1 | tyrosine-type recombinase/integrase | - |
| JN993_RS13750 | 2963649..2964113 | + | 465 | WP_003900539.1 | ParB N-terminal domain-containing protein | - |
| JN993_RS13755 | 2964101..2964352 | + | 252 | WP_003908028.1 | hypothetical protein | - |
| JN993_RS13760 | 2964523..2965960 | - | 1438 | Protein_2713 | phage major capsid protein | - |
| JN993_RS13765 | 2965968..2966501 | - | 534 | WP_003899412.1 | HK97 family phage prohead protease | - |
| JN993_RS13770 | 2966654..2967145 | - | 492 | WP_003900541.1 | phage terminase small subunit P27 family | - |
| JN993_RS13775 | 2967312..2967635 | - | 324 | WP_003909715.1 | type II toxin-antitoxin system toxin | Toxin |
| JN993_RS13780 | 2967715..2967960 | - | 246 | WP_003899415.1 | type II toxin-antitoxin system antitoxin | Antitoxin |
| JN993_RS13785 | 2967957..2969390 | - | 1434 | WP_105799846.1 | DUF3631 domain-containing protein | - |
| JN993_RS13790 | 2969392..2969784 | - | 393 | WP_003899417.1 | DUF2742 domain-containing protein | - |
| JN993_RS13795 | 2969781..2970041 | - | 261 | WP_003899418.1 | helix-turn-helix domain-containing protein | - |
| JN993_RS13800 | 2970058..2970420 | - | 363 | WP_003900543.1 | hypothetical protein | - |
| JN993_RS13805 | 2970423..2971550 | - | 1128 | WP_003899420.1 | site-specific integrase | - |
| JN993_RS13810 | 2971695..2971922 | - | 228 | WP_003899421.1 | hypothetical protein | - |
| JN993_RS13815 | 2971919..2972308 | - | 390 | WP_003899422.1 | hypothetical protein | - |
| JN993_RS13820 | 2972214..2972486 | + | 273 | WP_003900544.1 | hypothetical protein | - |
| JN993_RS13825 | 2972585..2972818 | + | 234 | WP_003413717.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2962637..2971550 | 8913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.81 Da Isoelectric Point: 8.6568
>T289707 WP_003909715.1 NZ_LR882496:c2967635-2967312 [Mycobacterium tuberculosis variant microti]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U8TVG5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A806JR81 |