289707

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2967312..2967960 Replicon chromosome
Accession NZ_LR882496
Organism Mycobacterium tuberculosis variant microti strain ATCC 35782 isolate vole

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID A0A7U8TVG5
Locus tag JN993_RS13775 Protein ID WP_003909715.1
Coordinates 2967312..2967635 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag JN993_RS13780 Protein ID WP_003899415.1
Coordinates 2967715..2967960 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN993_RS13745 2962637..2963635 + 999 WP_105799867.1 tyrosine-type recombinase/integrase -
JN993_RS13750 2963649..2964113 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
JN993_RS13755 2964101..2964352 + 252 WP_003908028.1 hypothetical protein -
JN993_RS13760 2964523..2965960 - 1438 Protein_2713 phage major capsid protein -
JN993_RS13765 2965968..2966501 - 534 WP_003899412.1 HK97 family phage prohead protease -
JN993_RS13770 2966654..2967145 - 492 WP_003900541.1 phage terminase small subunit P27 family -
JN993_RS13775 2967312..2967635 - 324 WP_003909715.1 type II toxin-antitoxin system toxin Toxin
JN993_RS13780 2967715..2967960 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
JN993_RS13785 2967957..2969390 - 1434 WP_105799846.1 DUF3631 domain-containing protein -
JN993_RS13790 2969392..2969784 - 393 WP_003899417.1 DUF2742 domain-containing protein -
JN993_RS13795 2969781..2970041 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
JN993_RS13800 2970058..2970420 - 363 WP_003900543.1 hypothetical protein -
JN993_RS13805 2970423..2971550 - 1128 WP_003899420.1 site-specific integrase -
JN993_RS13810 2971695..2971922 - 228 WP_003899421.1 hypothetical protein -
JN993_RS13815 2971919..2972308 - 390 WP_003899422.1 hypothetical protein -
JN993_RS13820 2972214..2972486 + 273 WP_003900544.1 hypothetical protein -
JN993_RS13825 2972585..2972818 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2962637..2971550 8913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.81 Da        Isoelectric Point: 8.6568

>T289707 WP_003909715.1 NZ_LR882496:c2967635-2967312 [Mycobacterium tuberculosis variant microti]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYQFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT289707 WP_003899415.1 NZ_LR882496:c2967960-2967715 [Mycobacterium tuberculosis variant microti]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U8TVG5

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References