Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2959568..2960216 Replicon chromosome
Accession NZ_CP127273
Organism Mycobacterium tuberculosis strain 3320

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag QQ046_RS13965 Protein ID WP_003899414.1
Coordinates 2959568..2959891 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag QQ046_RS13970 Protein ID WP_003899415.1
Coordinates 2959971..2960216 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ046_RS13945 (QQ046_13945) 2955142..2956403 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -
QQ046_RS13950 (QQ046_13950) 2956777..2958216 - 1440 WP_003901443.1 phage major capsid protein -
QQ046_RS13955 (QQ046_13955) 2958224..2958757 - 534 WP_003899412.1 HK97 family phage prohead protease -
QQ046_RS13960 (QQ046_13960) 2958910..2959401 - 492 WP_003900541.1 phage terminase small subunit P27 family -
QQ046_RS13965 (QQ046_13965) 2959568..2959891 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
QQ046_RS13970 (QQ046_13970) 2959971..2960216 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
QQ046_RS13975 (QQ046_13975) 2960213..2961640 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
QQ046_RS13980 (QQ046_13980) 2961642..2962034 - 393 WP_003899417.1 DUF2742 domain-containing protein -
QQ046_RS13985 (QQ046_13985) 2962031..2962291 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
QQ046_RS13990 (QQ046_13990) 2962308..2962670 - 363 WP_003900543.1 hypothetical protein -
QQ046_RS13995 (QQ046_13995) 2962673..2963800 - 1128 WP_003899420.1 site-specific integrase -
QQ046_RS14000 (QQ046_14000) 2963945..2964172 - 228 WP_003899421.1 hypothetical protein -
QQ046_RS14005 (QQ046_14005) 2964169..2964558 - 390 WP_003899422.1 hypothetical protein -
QQ046_RS14010 (QQ046_14010) 2964464..2964736 + 273 WP_003900544.1 hypothetical protein -
QQ046_RS14015 (QQ046_14015) 2964835..2965068 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2953533..2963800 10267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T283794 WP_003899414.1 NZ_CP127273:c2959891-2959568 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT283794 WP_003899415.1 NZ_CP127273:c2960216-2959971 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References