Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2958644..2959292 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag QRF07_RS13965 Protein ID WP_003899414.1
Coordinates 2958644..2958967 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag QRF07_RS13970 Protein ID WP_003899415.1
Coordinates 2959047..2959292 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS13945 (QRF07_13945) 2954218..2955479 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -
QRF07_RS13950 (QRF07_13950) 2955853..2957292 - 1440 WP_003901443.1 phage major capsid protein -
QRF07_RS13955 (QRF07_13955) 2957300..2957833 - 534 WP_003899412.1 HK97 family phage prohead protease -
QRF07_RS13960 (QRF07_13960) 2957986..2958477 - 492 WP_003900541.1 phage terminase small subunit P27 family -
QRF07_RS13965 (QRF07_13965) 2958644..2958967 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
QRF07_RS13970 (QRF07_13970) 2959047..2959292 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
QRF07_RS13975 (QRF07_13975) 2959289..2960716 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
QRF07_RS13980 (QRF07_13980) 2960718..2961110 - 393 WP_003899417.1 DUF2742 domain-containing protein -
QRF07_RS13985 (QRF07_13985) 2961107..2961367 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
QRF07_RS13990 (QRF07_13990) 2961384..2961746 - 363 WP_003900543.1 hypothetical protein -
QRF07_RS13995 (QRF07_13995) 2961749..2962876 - 1128 WP_003899420.1 site-specific integrase -
QRF07_RS14000 (QRF07_14000) 2963021..2963248 - 228 WP_003899421.1 hypothetical protein -
QRF07_RS14005 (QRF07_14005) 2963245..2963634 - 390 WP_003899422.1 hypothetical protein -
QRF07_RS14010 (QRF07_14010) 2963540..2963812 + 273 WP_003900544.1 hypothetical protein -
QRF07_RS14015 (QRF07_14015) 2963911..2964144 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2952609..2962876 10267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T284037 WP_003899414.1 NZ_CP127277:c2958967-2958644 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT284037 WP_003899415.1 NZ_CP127277:c2959292-2959047 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References