Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/- |
Location | 2751065..2751713 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | P9WJ12 |
Locus tag | PAK35_RS12795 | Protein ID | WP_003899414.1 |
Coordinates | 2751065..2751388 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ10 |
Locus tag | PAK35_RS12800 | Protein ID | WP_003899415.1 |
Coordinates | 2751468..2751713 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS12765 (PAK35_12765) | 2746388..2747386 | + | 999 | WP_003900538.1 | tyrosine-type recombinase/integrase | - |
PAK35_RS12770 (PAK35_12770) | 2747400..2747864 | + | 465 | WP_003900539.1 | ParB N-terminal domain-containing protein | - |
PAK35_RS12775 (PAK35_12775) | 2747852..2748103 | + | 252 | WP_003908028.1 | hypothetical protein | - |
PAK35_RS12780 (PAK35_12780) | 2748274..2749713 | - | 1440 | WP_003901443.1 | phage major capsid protein | - |
PAK35_RS12785 (PAK35_12785) | 2749721..2750254 | - | 534 | WP_003899412.1 | HK97 family phage prohead protease | - |
PAK35_RS12790 (PAK35_12790) | 2750407..2750898 | - | 492 | WP_003900541.1 | phage terminase small subunit P27 family | - |
PAK35_RS12795 (PAK35_12795) | 2751065..2751388 | - | 324 | WP_003899414.1 | type II toxin-antitoxin system toxin | Toxin |
PAK35_RS12800 (PAK35_12800) | 2751468..2751713 | - | 246 | WP_003899415.1 | type II toxin-antitoxin system antitoxin | Antitoxin |
PAK35_RS12805 (PAK35_12805) | 2751710..2753137 | - | 1428 | WP_003899416.1 | DUF3631 domain-containing protein | - |
PAK35_RS12810 (PAK35_12810) | 2753139..2753531 | - | 393 | WP_271093892.1 | DUF2742 domain-containing protein | - |
PAK35_RS12815 (PAK35_12815) | 2753528..2753788 | - | 261 | WP_003899418.1 | helix-turn-helix domain-containing protein | - |
PAK35_RS12820 (PAK35_12820) | 2753805..2754167 | - | 363 | WP_003900543.1 | hypothetical protein | - |
PAK35_RS12825 (PAK35_12825) | 2754170..2755297 | - | 1128 | WP_003899420.1 | site-specific integrase | - |
PAK35_RS12830 (PAK35_12830) | 2755442..2755669 | - | 228 | WP_003899421.1 | hypothetical protein | - |
PAK35_RS12835 (PAK35_12835) | 2755666..2756055 | - | 390 | WP_003899422.1 | hypothetical protein | - |
PAK35_RS12840 (PAK35_12840) | 2755961..2756233 | + | 273 | WP_003900544.1 | hypothetical protein | - |
PAK35_RS12845 (PAK35_12845) | 2756332..2756565 | + | 234 | WP_003413717.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2746388..2758384 | 11996 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12359.82 Da Isoelectric Point: 8.6717
>T267124 WP_003899414.1 NZ_CP115447:c2751388-2751065 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A045IHC4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JR81 |