Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2751065..2751713 Replicon chromosome
Accession NZ_CP115447
Organism Mycobacterium tuberculosis strain BLR 9248 2019

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag PAK35_RS12795 Protein ID WP_003899414.1
Coordinates 2751065..2751388 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag PAK35_RS12800 Protein ID WP_003899415.1
Coordinates 2751468..2751713 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAK35_RS12765 (PAK35_12765) 2746388..2747386 + 999 WP_003900538.1 tyrosine-type recombinase/integrase -
PAK35_RS12770 (PAK35_12770) 2747400..2747864 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
PAK35_RS12775 (PAK35_12775) 2747852..2748103 + 252 WP_003908028.1 hypothetical protein -
PAK35_RS12780 (PAK35_12780) 2748274..2749713 - 1440 WP_003901443.1 phage major capsid protein -
PAK35_RS12785 (PAK35_12785) 2749721..2750254 - 534 WP_003899412.1 HK97 family phage prohead protease -
PAK35_RS12790 (PAK35_12790) 2750407..2750898 - 492 WP_003900541.1 phage terminase small subunit P27 family -
PAK35_RS12795 (PAK35_12795) 2751065..2751388 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
PAK35_RS12800 (PAK35_12800) 2751468..2751713 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
PAK35_RS12805 (PAK35_12805) 2751710..2753137 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
PAK35_RS12810 (PAK35_12810) 2753139..2753531 - 393 WP_271093892.1 DUF2742 domain-containing protein -
PAK35_RS12815 (PAK35_12815) 2753528..2753788 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
PAK35_RS12820 (PAK35_12820) 2753805..2754167 - 363 WP_003900543.1 hypothetical protein -
PAK35_RS12825 (PAK35_12825) 2754170..2755297 - 1128 WP_003899420.1 site-specific integrase -
PAK35_RS12830 (PAK35_12830) 2755442..2755669 - 228 WP_003899421.1 hypothetical protein -
PAK35_RS12835 (PAK35_12835) 2755666..2756055 - 390 WP_003899422.1 hypothetical protein -
PAK35_RS12840 (PAK35_12840) 2755961..2756233 + 273 WP_003900544.1 hypothetical protein -
PAK35_RS12845 (PAK35_12845) 2756332..2756565 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2746388..2758384 11996


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T267124 WP_003899414.1 NZ_CP115447:c2751388-2751065 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT267124 WP_003899415.1 NZ_CP115447:c2751713-2751468 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References