Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2983227..2983875 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag DKC2_RS14560 Protein ID WP_003899414.1
Coordinates 2983227..2983550 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag DKC2_RS14565 Protein ID WP_003899415.1
Coordinates 2983630..2983875 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS14530 2978550..2979548 + 999 WP_003900538.1 tyrosine-type recombinase/integrase -
DKC2_RS14535 2979562..2980026 + 465 WP_003900539.1 ParB N-terminal domain-containing protein -
DKC2_RS14540 2980014..2980265 + 252 WP_003908028.1 hypothetical protein -
DKC2_RS14545 2980436..2981875 - 1440 WP_003899411.1 phage major capsid protein -
DKC2_RS14550 2981883..2982416 - 534 WP_003899412.1 HK97 family phage prohead protease -
DKC2_RS14555 2982569..2983060 - 492 WP_003900541.1 phage terminase small subunit P27 family -
DKC2_RS14560 2983227..2983550 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
DKC2_RS14565 2983630..2983875 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
DKC2_RS14570 2983872..2985299 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
DKC2_RS14575 2985301..2985693 - 393 WP_003899417.1 DUF2742 domain-containing protein -
DKC2_RS14580 2985690..2985950 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
DKC2_RS14585 2985967..2986329 - 363 WP_003900543.1 hypothetical protein -
DKC2_RS14590 2986332..2987459 - 1128 WP_003899420.1 site-specific integrase -
DKC2_RS14595 2987604..2987831 - 228 WP_003899421.1 hypothetical protein -
DKC2_RS14600 2987828..2988217 - 390 WP_003899422.1 hypothetical protein -
DKC2_RS14605 2988123..2988395 + 273 WP_003900544.1 hypothetical protein -
DKC2_RS14610 2988494..2988727 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2978550..2987459 8909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T285969 WP_003899414.1 NZ_LR027516:c2983550-2983227 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT285969 WP_003899415.1 NZ_LR027516:c2983875-2983630 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References