Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/- |
Location | 2983227..2983875 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | P9WJ12 |
Locus tag | DKC2_RS14560 | Protein ID | WP_003899414.1 |
Coordinates | 2983227..2983550 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ10 |
Locus tag | DKC2_RS14565 | Protein ID | WP_003899415.1 |
Coordinates | 2983630..2983875 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS14530 | 2978550..2979548 | + | 999 | WP_003900538.1 | tyrosine-type recombinase/integrase | - |
DKC2_RS14535 | 2979562..2980026 | + | 465 | WP_003900539.1 | ParB N-terminal domain-containing protein | - |
DKC2_RS14540 | 2980014..2980265 | + | 252 | WP_003908028.1 | hypothetical protein | - |
DKC2_RS14545 | 2980436..2981875 | - | 1440 | WP_003899411.1 | phage major capsid protein | - |
DKC2_RS14550 | 2981883..2982416 | - | 534 | WP_003899412.1 | HK97 family phage prohead protease | - |
DKC2_RS14555 | 2982569..2983060 | - | 492 | WP_003900541.1 | phage terminase small subunit P27 family | - |
DKC2_RS14560 | 2983227..2983550 | - | 324 | WP_003899414.1 | type II toxin-antitoxin system toxin | Toxin |
DKC2_RS14565 | 2983630..2983875 | - | 246 | WP_003899415.1 | type II toxin-antitoxin system antitoxin | Antitoxin |
DKC2_RS14570 | 2983872..2985299 | - | 1428 | WP_003899416.1 | DUF3631 domain-containing protein | - |
DKC2_RS14575 | 2985301..2985693 | - | 393 | WP_003899417.1 | DUF2742 domain-containing protein | - |
DKC2_RS14580 | 2985690..2985950 | - | 261 | WP_003899418.1 | helix-turn-helix domain-containing protein | - |
DKC2_RS14585 | 2985967..2986329 | - | 363 | WP_003900543.1 | hypothetical protein | - |
DKC2_RS14590 | 2986332..2987459 | - | 1128 | WP_003899420.1 | site-specific integrase | - |
DKC2_RS14595 | 2987604..2987831 | - | 228 | WP_003899421.1 | hypothetical protein | - |
DKC2_RS14600 | 2987828..2988217 | - | 390 | WP_003899422.1 | hypothetical protein | - |
DKC2_RS14605 | 2988123..2988395 | + | 273 | WP_003900544.1 | hypothetical protein | - |
DKC2_RS14610 | 2988494..2988727 | + | 234 | WP_003413717.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2978550..2987459 | 8909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12359.82 Da Isoelectric Point: 8.6717
>T285969 WP_003899414.1 NZ_LR027516:c2983550-2983227 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A045IHC4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JR81 |