295332

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 1389338..1389986 Replicon chromosome
Accession NZ_OW052571
Organism Mycobacterium tuberculosis strain Lineage 4.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag MR179_RS06425 Protein ID WP_003899414.1
Coordinates 1389663..1389986 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag MR179_RS06420 Protein ID WP_003899415.1
Coordinates 1389338..1389583 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR179_RS06375 1384486..1384719 - 234 WP_003413717.1 hypothetical protein -
MR179_RS06380 1384818..1385090 - 273 WP_003900544.1 hypothetical protein -
MR179_RS06385 1384996..1385385 + 390 WP_003899422.1 hypothetical protein -
MR179_RS06390 1385382..1385609 + 228 WP_003899421.1 hypothetical protein -
MR179_RS06395 1385754..1386881 + 1128 WP_003899420.1 site-specific integrase -
MR179_RS06400 1386884..1387246 + 363 WP_003900543.1 hypothetical protein -
MR179_RS06405 1387263..1387523 + 261 WP_003899418.1 helix-turn-helix domain-containing protein -
MR179_RS06410 1387520..1387912 + 393 WP_003899417.1 DUF2742 domain-containing protein -
MR179_RS06415 1387914..1389341 + 1428 WP_003899416.1 DUF3631 domain-containing protein -
MR179_RS06420 1389338..1389583 + 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
MR179_RS06425 1389663..1389986 + 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
MR179_RS06430 1390153..1390644 + 492 WP_003900541.1 phage terminase small subunit P27 family -
MR179_RS06435 1390797..1391330 + 534 WP_003899412.1 HK97 family phage prohead protease -
MR179_RS06440 1391338..1392777 + 1440 WP_003899411.1 phage major capsid protein -
MR179_RS06445 1392948..1393199 - 252 WP_003908028.1 hypothetical protein -
MR179_RS06450 1393187..1393651 - 465 WP_003900539.1 ParB N-terminal domain-containing protein -
MR179_RS06455 1393665..1394663 - 999 WP_003900538.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1385754..1394663 8909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T295332 WP_003899414.1 NZ_OW052571:1389663-1389986 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT295332 WP_003899415.1 NZ_OW052571:1389338-1389583 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References