Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) unclassified/-
Location 2955695..2956343 Replicon chromosome
Accession NZ_CP127275
Organism Mycobacterium tuberculosis strain 6721

Toxin (Protein)


Gene name novel[antitoxin] Uniprot ID P9WJ12
Locus tag QRF09_RS13965 Protein ID WP_003899414.1
Coordinates 2955695..2956018 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name novel[toxin] Uniprot ID P9WJ10
Locus tag QRF09_RS13970 Protein ID WP_003899415.1
Coordinates 2956098..2956343 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF09_RS13945 (QRF09_13945) 2951269..2952530 + 1262 WP_087902221.1 IS3-like element IS987 family transposase -
QRF09_RS13950 (QRF09_13950) 2952904..2954343 - 1440 WP_003901443.1 phage major capsid protein -
QRF09_RS13955 (QRF09_13955) 2954351..2954884 - 534 WP_003899412.1 HK97 family phage prohead protease -
QRF09_RS13960 (QRF09_13960) 2955037..2955528 - 492 WP_003900541.1 phage terminase small subunit P27 family -
QRF09_RS13965 (QRF09_13965) 2955695..2956018 - 324 WP_003899414.1 type II toxin-antitoxin system toxin Toxin
QRF09_RS13970 (QRF09_13970) 2956098..2956343 - 246 WP_003899415.1 type II toxin-antitoxin system antitoxin Antitoxin
QRF09_RS13975 (QRF09_13975) 2956340..2957767 - 1428 WP_003899416.1 DUF3631 domain-containing protein -
QRF09_RS13980 (QRF09_13980) 2957769..2958161 - 393 WP_003899417.1 DUF2742 domain-containing protein -
QRF09_RS13985 (QRF09_13985) 2958158..2958418 - 261 WP_003899418.1 helix-turn-helix domain-containing protein -
QRF09_RS13990 (QRF09_13990) 2958435..2958797 - 363 WP_003900543.1 hypothetical protein -
QRF09_RS13995 (QRF09_13995) 2958800..2959927 - 1128 WP_003899420.1 site-specific integrase -
QRF09_RS14000 (QRF09_14000) 2960072..2960299 - 228 WP_003899421.1 hypothetical protein -
QRF09_RS14005 (QRF09_14005) 2960296..2960685 - 390 WP_003899422.1 hypothetical protein -
QRF09_RS14010 (QRF09_14010) 2960591..2960863 + 273 WP_003900544.1 hypothetical protein -
QRF09_RS14015 (QRF09_14015) 2960962..2961195 + 234 WP_003413717.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2949660..2959927 10267


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12359.82 Da        Isoelectric Point: 8.6717

>T283915 WP_003899414.1 NZ_CP127275:c2956018-2955695 [Mycobacterium tuberculosis]
MTHKRTKRQPAIAAGLNAPRRNRVGRQHGWPADVPSAEQRRAQRQRDLEAIRRAYAEMVATSHEIDDDTAELALLSMHLD
DEQRRLEAGMKLGWHPYHFPDEPDSKQ

Download         Length: 324 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 7697.71 Da        Isoelectric Point: 4.8565

>AT283915 WP_003899415.1 NZ_CP127275:c2956343-2956098 [Mycobacterium tuberculosis]
MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDP
P

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A045IHC4

Antitoxin

Source ID Structure
AlphaFold DB A0A806JR81

References