Detailed information of TA system TA006321

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrG/-
• Location: 2273594..2273884
• Replicon: chromosome
• Accession: NC_000964
• Organism: Bacillus subtilis subsp. subtilis str. 168
• T1TAdb ID: TA04735

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: -
• Locus tag: BSU21546
• Protein ID: YP_009513970.1
• Coordinates: 2273594..2273710 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrG
Locus tag	BSU_misc_RNA_77
Coordinates	2273705..2273884 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BSU_21480 (BSU21480)	2269521..2269691	-	171	NP_390031.1	sublancin 168 lantibiotic antimicrobial precursor peptide; SPBeta prophage	-
BSU_21490 (BSU21490)	2269988..2270305	-	318	NP_390032.1	protein of immunity to sublancin	-
BSU_21500 (BSU21500)	2270407..2271657	-	1251	NP_390033.2	lesion bypass phage DNA polymerase; phage SPbeta	-
BSU_21510 (BSU21510)	2271650..2271982	-	333	NP_390034.1	conserved hypothetical protein; phage SPbeta	-
BSU_21520 (BSU21520)	2272156..2272491	+	336	NP_390035.1	conserved phage protein of unknown function; phage SPbeta	-
BSU_21530 (BSU21530)	2272534..2272890	-	357	NP_390036.1	conserved protein of unknown function; phage SPbeta	-
BSU_21540 (BSU21540)	2272896..2273363	-	468	NP_390037.1	conserved exported protein of unknown function; SPbeta phage	-
BSU_21546 (BSU21546)	2273594..2273710	+	117	YP_009513970.1	phage toxin; type I toxin-antitoxin system	Toxin
-	2273705..2273884	-	180	-	-	Antitoxin
BSU_21550 (BSU21550)	2273989..2274522	-	534	NP_390038.1	putative N-acetyltransferase; phage SPbeta	-
BSU_21560 (BSU21560)	2274558..2275136	-	579	NP_390039.1	conserved protein of unknown function; phage SPbeta	-
BSU_21570 (BSU21570)	2275200..2275697	-	498	NP_390040.1	conserved protein of unknown function; phage SPbeta	-
BSU_21580 (BSU21580)	2275706..2277421	-	1716	NP_390041.2	putative RNase; phage SPbeta	-
BSU_21590 (BSU21590)	2277521..2278078	-	558	NP_390042.1	conserved protein of unknown function; phage SPbeta	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_018520 Bacillus subtilis QB928 Prophage TA028187, TA028190, TA028193, TA028197 2131121..2265901 0 View NZ_AP019714 Bacillus subtilis subsp. subtilis strain NBRC 13719 Prophage TA032934, TA032937, TA032940, TA032944 2146857..2295886 0.003 View NZ_AP024621 Bacillus subtilis strain BEST3095 Prophage TA038966, TA038969, TA038972, TA038976 2130929..2265709 0 View NZ_AP024622 Bacillus subtilis strain BEST3096 Prophage TA038989, TA038992, TA038995, TA038999 2130796..2265576 0 View NZ_AP024623 Bacillus subtilis strain BEST3102 Prophage TA039012, TA039015, TA039018, TA039022 2120228..2255008 0 View NZ_AP024624 Bacillus subtilis strain BEST3106 Prophage TA039045, TA039035, TA039038, TA039041 2117443..2266470 0.003 View NZ_AP024625 Bacillus subtilis strain BEST3109 Prophage TA039058, TA039061, TA039064, TA039068 2117724..2266751 0.003 View NZ_AP024626 Bacillus subtilis strain BEST3125 Prophage TA039081, TA039084, TA039087, TA039091 2117462..2266489 0.003 View NZ_AP024627 Bacillus subtilis strain BEST3136 Prophage TA039104, TA039107, TA039110, TA039114 2123843..2258623 0 View NZ_AP024628 Bacillus subtilis strain BEST3145 Prophage TA039127, TA039130, TA039133, TA039137 2123406..2258186 0 View NZ_CP007800 Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642 Prophage TA047063, TA047066, TA047069, TA047073 2124394..2259176 0 View NZ_CP008698 Bacillus subtilis subsp. subtilis str. AG1839 Prophage TA047257, TA047260, TA047263, TA047267 2124394..2259176 0 View NZ_CP010052 Bacillus subtilis subsp. subtilis str. 168 Prophage TA050282, TA050285, TA050288, TA050292 2151639..2311898 0.004 View NZ_CP010053 Bacillus subtilis strain PS832 Prophage TA050305, TA050308, TA050311, TA050315 2151386..2286168 0 View NZ_CP010314 Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet) Prophage TA051995, TA051998, TA052001, TA052005 2131118..2265900 0 View NZ_CP011115 Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028 Prophage TA053432, TA053435, TA053438, TA053442 2151632..2286414 0 View NZ_CP015004 Bacillus subtilis strain SZMC 6179J isolate B23 Prophage TA062004, TA062007, TA062010, TA062014 2131241..2266023 0 View NZ_CP015375 Bacillus subtilis subsp. subtilis strain KCTC 3135 Prophage TA062918, TA062922, TA062926, TA062929 2325154..2460581 0 View NZ_CP016852 Bacillus subtilis subsp. subtilis strain 168G Prophage TA065204, TA065207, TA065210, TA065214 2151042..2285804 0 View NZ_CP020102 Bacillus subtilis strain NCIB 3610 Prophage TA074080, TA074083, TA074086, TA074090 2151659..2286440 0 View NZ_CP032310 Bacillus subtilis strain WB800N Prophage TA111619, TA111622, TA111625, TA111629 2151258..2286037 0 View NZ_CP045812 Bacillus subtilis strain P8_B3 Prophage TA142634, TA142637, TA142640, TA142644 2151218..2286000 0 View NZ_CP045821 Bacillus subtilis strain MB8_B7 Prophage TA142687, TA142690, TA142693, TA142697 2130712..2267283 0.001 View NZ_CP045922 Bacillus subtilis strain P8_B1 Prophage TA143007, TA143010, TA143013, TA143017 2151218..2286000 0 View NZ_CP050532 Bacillus subtilis subsp. subtilis str. SMY Prophage TA153024, TA153027, TA153030, TA153034 2144927..2279709 0 View NZ_CP058242 Bacillus subtilis strain SP1 Prophage TA166384, TA166387, TA166390, TA166394 2151630..2286412 0 View NZ_CP064093 Bacillus subtilis strain N1282-4at Prophage TA180035, TA180039, TA180043, TA180046 2982784..3118211 0 View NZ_CP064094 Bacillus subtilis strain N1108-5at Prophage TA180059, TA180063, TA180067, TA180070 3385454..3534483 0.003 View NZ_CP064095 Bacillus subtilis strain N1303-2Ay Prophage TA180082, TA180086, TA180090, TA180093 3874311..4023340 0.003 View NZ_CP064096 Bacillus subtilis strain N1142-3at Prophage TA180103, TA180107, TA180111, TA180114 1327445..1487704 0.004 View NZ_CP065789 Bacillus subtilis strain LBUM979 Prophage TA183377, TA183380, TA183383, TA183387 2151233..2286015 0 View NZ_CP075344 Bacillus subtilis subsp. subtilis strain A1 - Midalam Prophage TA203471, TA203474, TA203477, TA203481 2151255..2286691 0.001 View NZ_CP082924 Bacillus subtilis strain FJAT-4 Prophage TA215599, TA215602, TA215605, TA215609 2151226..2286650 0 View NZ_CP089592 Bacillus subtilis strain Bsi Prophage TA228394, TA228397, TA228400, TA228404 2156228..2316487 0.004 View NZ_CP094361 Bacillus subtilis strain NCIB 3610 Prophage TA239787, TA239790, TA239793, TA239797 2146850..2307109 0.004 View NZ_CP101937 Bacillus subtilis strain RUB331 Prophage TA253024, TA253026, TA253027, TA253029, TA253033 2130725..2265507 0 View NZ_CP102769 Bacillus subtilis strain YZSR384 Prophage TA254167, TA254169, TA254170, TA254172, TA254176 2151226..2286008 0 View NZ_CP103066 Bacillus subtilis strain 0137 Prophage TA254832, TA254834, TA254835, TA254837, TA254841 2151265..2286041 0 View NZ_CP103783 Bacillus subtilis subsp. subtilis str. 168 Prophage TA256647, TA256649, TA256650, TA256652, TA256656 2151085..2285867 0 View NZ_CP103783 Bacillus subtilis subsp. subtilis str. 168 Prophage TA256647, TA256649, TA256650, TA256652, TA256656 2151085..2311344 0.004 View NZ_CP112873 Bacillus subtilis strain O4 Prophage TA264903, TA264905, TA264906, TA264908, TA264912 2153436..2288218 0 View NZ_CP120613 Bacillus subtilis strain DSM 23521 Prophage TA275255, TA275259, TA275263, TA275264, TA275266 2855647..3004673 0.003 View NZ_CP120681 Bacillus subtilis strain DSM 10 Prophage TA275352, TA275354, TA275355, TA275357, TA275361 1516355..1665384 0.003 View NZ_CP125660 Bacillus subtilis strain GUCC48 Prophage TA282253, TA282255, TA282256, TA282258, TA282262 2151237..2286019 0 View NZ_CP125762 Bacillus subtilis strain KRS015 Prophage TA282356, TA282360, TA282364, TA282365, TA282367, TA282369, TA282373, TA282377, TA282378, TA282380 2012030..2280951 0 View NZ_LN649259 Bacillus subtilis strain BS49 Prophage TA285504, TA285506, TA285507, TA285509, TA285513 2169638..2304418 0 View NZ_LN680001 Bacillus subtilis strain BS34A Prophage TA285525, TA285527, TA285528, TA285530, TA285534 2169640..2304420 0 View NZ_LN680001 Bacillus subtilis strain BS34A Prophage TA285525, TA285527, TA285528, TA285530, TA285534 2169640..2305065 0 View NZ_OX419569 Bacillus subtilis isolate NRS6118 Prophage TA296848, TA296850, TA296851, TA296853, TA296857 2195159..2345976 0.003 View NZ_OX419580 Bacillus subtilis isolate NRS6116 Prophage TA296932, TA296934, TA296935, TA296937, TA296941 2200159..2334941 0	inside	Prophage	-	-	2151626..2286408	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T6321 YP_009513970.1 NC_000964:2273594-2273710 [Bacillus subtilis subsp. subtilis str. 168]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T6321 NC_000964:2273594-2273710 [Bacillus subtilis subsp. subtilis str. 168]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG

Antitoxin

Nucleotide

• Length: 180 bp

>AT6321 NC_000964:c2273884-2273705 [Bacillus subtilis subsp. subtilis str. 168]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10205	Enterococcus faecalis V583	37.838	97.368	0.368
T6278	Enterococcus faecalis V583	50	66.667	0.333
T10204	Enterococcus faecalis V583	29.73	100	0.324

Multiple sequence alignment

Structures

Antitoxin

References

(1) Natalie Jahn et al. (2013) One antitoxin--two functions: SR4 controls toxin mRNA decay and translation. Nucleic Acids Research 41(21):9870-80. [PubMed:23969414]

(2) Sylvain Durand et al. (2012) Type I toxin-antitoxin systems in Bacillus subtilis. RNA Biology 9(12):1491-7. [PubMed:23059907]


 experimental literature