Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 2219202..2219419 | Replicon | chromosome |
| Accession | NZ_CP103783 | ||
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | O31941 |
| Locus tag | NYR92_RS11450 | Protein ID | WP_009967515.1 |
| Coordinates | 2219243..2219419 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2219202..2219302 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR92_RS11420 | 2214431..2214658 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
| NYR92_RS11425 | 2214919..2216235 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
| NYR92_RS11430 | 2216592..2217098 | - | 507 | WP_004399486.1 | hypothetical protein | - |
| NYR92_RS11435 | 2217426..2218658 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
| NYR92_RS11440 | 2218740..2218928 | - | 189 | WP_004399547.1 | hypothetical protein | - |
| NYR92_RS11445 | 2218973..2219224 | - | 252 | WP_010886546.1 | hypothetical protein | - |
| - | 2219202..2219302 | + | 101 | - | - | Antitoxin |
| NYR92_RS11450 | 2219243..2219419 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
| - | 2219360..2219460 | + | 101 | NuclAT_2 | - | - |
| - | 2219360..2219460 | + | 101 | NuclAT_2 | - | - |
| - | 2219360..2219460 | + | 101 | NuclAT_2 | - | - |
| - | 2219360..2219460 | + | 101 | NuclAT_2 | - | - |
| NYR92_RS11455 | 2219794..2220405 | - | 612 | WP_009967516.1 | lipoprotein | - |
| NYR92_RS11460 | 2220520..2220846 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
| NYR92_RS11465 | 2221799..2221993 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2151085..2311344 | 160259 | ||
| inside | Prophage | - | - | 2151085..2285867 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T256650 WP_009967515.1 NZ_CP103783:c2219419-2219243 [Bacillus subtilis subsp. subtilis str. 168]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT256650 NZ_CP103783:2219202-2219302 [Bacillus subtilis subsp. subtilis str. 168]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|