Detailed information of TA system TA006323

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): yonT-SR6/-
• Location: 2219784..2220001
• Replicon: chromosome
• Accession: NC_000964
• Organism: Bacillus subtilis subsp. subtilis str. 168
• T1TAdb ID: TA04738

Toxin (Protein)

• Gene name: yonT
• Uniprot ID: O31941
• Locus tag: BSU21000
• Protein ID: NP_389983.1
• Coordinates: 2219784..2219960 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	SR6
Locus tag	BSU_misc_RNA_90
Coordinates	2219743..2219843 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BSU_20950 (BSU20950)	2214972..2215199	-	228	NP_389978.1	putative transcriptional regulator, lambda repressor-like; phage SPbeta	-
BSU_20960 (BSU20960)	2215460..2216776	-	1317	NP_389979.1	conserved protein of unknown function; phage SPbeta	-
BSU_20970 (BSU20970)	2217133..2217639	-	507	NP_389980.1	conserved protein of unknown function; phage SPbeta	-
BSU_20980 (BSU20980)	2217967..2219199	-	1233	NP_389981.1	conserved protein of unknown function; phage SPbeta	-
BSU_20990 (BSU20990)	2219281..2219469	-	189	NP_389982.1	conserved protein of unknown function; phage SPbeta	-
BSU_20999 (BSU20999)	2219514..2219765	-	252	YP_003097750.1	conserved protein of unknown function (toxin/antitoxin island); phage SPbeta	-
-	2219743..2219843	+	101	-	-	Antitoxin
BSU_21000 (BSU21000)	2219784..2219960	-	177	NP_389983.1	toxin; phage SPbeta	Toxin
BSU_21010 (BSU21010)	2220335..2220946	-	612	NP_389984.1	putative hydrolase lipoprotein; phage SPbeta	-
BSU_21020 (BSU21020)	2221061..2221387	-	327	NP_389985.1	putative transcriptional regulator (Xre family); phage SPbeta	-
BSU_21030 (BSU21030)	2222340..2222534	+	195	NP_389986.1	hypothetical protein; phage SPbeta	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_018520 Bacillus subtilis QB928 Prophage TA028187, TA028190, TA028193, TA028197 2131121..2265901 0 View NZ_AP019714 Bacillus subtilis subsp. subtilis strain NBRC 13719 Prophage TA032934, TA032937, TA032940, TA032944 2146857..2295886 0.003 View NZ_AP024621 Bacillus subtilis strain BEST3095 Prophage TA038966, TA038969, TA038972, TA038976 2130929..2265709 0 View NZ_AP024622 Bacillus subtilis strain BEST3096 Prophage TA038989, TA038992, TA038995, TA038999 2130796..2265576 0 View NZ_AP024623 Bacillus subtilis strain BEST3102 Prophage TA039012, TA039015, TA039018, TA039022 2120228..2255008 0 View NZ_AP024624 Bacillus subtilis strain BEST3106 Prophage TA039045, TA039035, TA039038, TA039041 2117443..2266470 0.003 View NZ_AP024625 Bacillus subtilis strain BEST3109 Prophage TA039058, TA039061, TA039064, TA039068 2117724..2266751 0.003 View NZ_AP024626 Bacillus subtilis strain BEST3125 Prophage TA039081, TA039084, TA039087, TA039091 2117462..2266489 0.003 View NZ_AP024627 Bacillus subtilis strain BEST3136 Prophage TA039104, TA039107, TA039110, TA039114 2123843..2258623 0 View NZ_AP024628 Bacillus subtilis strain BEST3145 Prophage TA039127, TA039130, TA039133, TA039137 2123406..2258186 0 View NZ_CP007800 Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642 Prophage TA047063, TA047066, TA047069, TA047073 2124394..2259176 0 View NZ_CP008698 Bacillus subtilis subsp. subtilis str. AG1839 Prophage TA047257, TA047260, TA047263, TA047267 2124394..2259176 0 View NZ_CP010052 Bacillus subtilis subsp. subtilis str. 168 Prophage TA050282, TA050285, TA050288, TA050292 2151639..2311898 0.004 View NZ_CP010053 Bacillus subtilis strain PS832 Prophage TA050305, TA050308, TA050311, TA050315 2151386..2286168 0 View NZ_CP010314 Bacillus subtilis subsp. subtilis strain 3NA isolate 1970 (Michel and Millet) Prophage TA051995, TA051998, TA052001, TA052005 2131118..2265900 0 View NZ_CP011115 Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028 Prophage TA053432, TA053435, TA053438, TA053442 2151632..2286414 0 View NZ_CP015004 Bacillus subtilis strain SZMC 6179J isolate B23 Prophage TA062004, TA062007, TA062010, TA062014 2131241..2266023 0 View NZ_CP015375 Bacillus subtilis subsp. subtilis strain KCTC 3135 Prophage TA062918, TA062922, TA062926, TA062929 2325154..2460581 0 View NZ_CP016852 Bacillus subtilis subsp. subtilis strain 168G Prophage TA065204, TA065207, TA065210, TA065214 2151042..2285804 0 View NZ_CP020102 Bacillus subtilis strain NCIB 3610 Prophage TA074080, TA074083, TA074086, TA074090 2151659..2286440 0 View NZ_CP032310 Bacillus subtilis strain WB800N Prophage TA111619, TA111622, TA111625, TA111629 2151258..2286037 0 View NZ_CP045812 Bacillus subtilis strain P8_B3 Prophage TA142634, TA142637, TA142640, TA142644 2151218..2286000 0 View NZ_CP045821 Bacillus subtilis strain MB8_B7 Prophage TA142687, TA142690, TA142693, TA142697 2130712..2267283 0.001 View NZ_CP045922 Bacillus subtilis strain P8_B1 Prophage TA143007, TA143010, TA143013, TA143017 2151218..2286000 0 View NZ_CP050532 Bacillus subtilis subsp. subtilis str. SMY Prophage TA153024, TA153027, TA153030, TA153034 2144927..2279709 0 View NZ_CP058242 Bacillus subtilis strain SP1 Prophage TA166384, TA166387, TA166390, TA166394 2151630..2286412 0 View NZ_CP064093 Bacillus subtilis strain N1282-4at Prophage TA180035, TA180039, TA180043, TA180046 2982784..3118211 0 View NZ_CP064094 Bacillus subtilis strain N1108-5at Prophage TA180059, TA180063, TA180067, TA180070 3385454..3534483 0.003 View NZ_CP064095 Bacillus subtilis strain N1303-2Ay Prophage TA180082, TA180086, TA180090, TA180093 3874311..4023340 0.003 View NZ_CP064096 Bacillus subtilis strain N1142-3at Prophage TA180103, TA180107, TA180111, TA180114 1327445..1487704 0.004 View NZ_CP065789 Bacillus subtilis strain LBUM979 Prophage TA183377, TA183380, TA183383, TA183387 2151233..2286015 0 View NZ_CP075344 Bacillus subtilis subsp. subtilis strain A1 - Midalam Prophage TA203471, TA203474, TA203477, TA203481 2151255..2286691 0.001 View NZ_CP082924 Bacillus subtilis strain FJAT-4 Prophage TA215599, TA215602, TA215605, TA215609 2151226..2286650 0 View NZ_CP089592 Bacillus subtilis strain Bsi Prophage TA228394, TA228397, TA228400, TA228404 2156228..2316487 0.004 View NZ_CP094361 Bacillus subtilis strain NCIB 3610 Prophage TA239787, TA239790, TA239793, TA239797 2146850..2307109 0.004 View NZ_CP101937 Bacillus subtilis strain RUB331 Prophage TA253024, TA253026, TA253027, TA253029, TA253033 2130725..2265507 0 View NZ_CP102769 Bacillus subtilis strain YZSR384 Prophage TA254167, TA254169, TA254170, TA254172, TA254176 2151226..2286008 0 View NZ_CP103066 Bacillus subtilis strain 0137 Prophage TA254832, TA254834, TA254835, TA254837, TA254841 2151265..2286041 0 View NZ_CP103783 Bacillus subtilis subsp. subtilis str. 168 Prophage TA256647, TA256649, TA256650, TA256652, TA256656 2151085..2285867 0 View NZ_CP103783 Bacillus subtilis subsp. subtilis str. 168 Prophage TA256647, TA256649, TA256650, TA256652, TA256656 2151085..2311344 0.004 View NZ_CP112873 Bacillus subtilis strain O4 Prophage TA264903, TA264905, TA264906, TA264908, TA264912 2153436..2288218 0 View NZ_CP120613 Bacillus subtilis strain DSM 23521 Prophage TA275255, TA275259, TA275263, TA275264, TA275266 2855647..3004673 0.003 View NZ_CP120681 Bacillus subtilis strain DSM 10 Prophage TA275352, TA275354, TA275355, TA275357, TA275361 1516355..1665384 0.003 View NZ_CP125660 Bacillus subtilis strain GUCC48 Prophage TA282253, TA282255, TA282256, TA282258, TA282262 2151237..2286019 0 View NZ_CP125762 Bacillus subtilis strain KRS015 Prophage TA282356, TA282360, TA282364, TA282365, TA282367, TA282369, TA282373, TA282377, TA282378, TA282380 2012030..2280951 0 View NZ_LN649259 Bacillus subtilis strain BS49 Prophage TA285504, TA285506, TA285507, TA285509, TA285513 2169638..2304418 0 View NZ_LN680001 Bacillus subtilis strain BS34A Prophage TA285525, TA285527, TA285528, TA285530, TA285534 2169640..2304420 0 View NZ_LN680001 Bacillus subtilis strain BS34A Prophage TA285525, TA285527, TA285528, TA285530, TA285534 2169640..2305065 0 View NZ_OX419569 Bacillus subtilis isolate NRS6118 Prophage TA296848, TA296850, TA296851, TA296853, TA296857 2195159..2345976 0.003 View NZ_OX419580 Bacillus subtilis isolate NRS6116 Prophage TA296932, TA296934, TA296935, TA296937, TA296941 2200159..2334941 0	inside	Prophage	-	-	2151626..2286408	134782

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6882.45 Da
• Isoelectric Point: 12.8833

>T6323 NP_389983.1 NC_000964:c2219960-2219784 [Bacillus subtilis subsp. subtilis str. 168]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR

Nucleotide

• Length: 177 bp

>T6323 NC_000964:c2219960-2219784 [Bacillus subtilis subsp. subtilis str. 168]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA

Antitoxin

Nucleotide

• Length: 101 bp

>AT6323 NC_000964:2219743-2219843 [Bacillus subtilis subsp. subtilis str. 168]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT

Structures

Toxin

• AlphaFold DB: O31941

Antitoxin

References

(1) Elizabeth M Fozo et al. (2010) Abundance of type I toxin-antitoxin systems in bacteria: searches for new candidates and discovery of novel families. Nucleic Acids Research 38(11):3743-59. [PubMed:20156992]

(2) Sylvain Durand et al. (2012) The essential function of B. subtilis RNase III is to silence foreign toxin genes. PLoS Genetics 8(12):e1003181. [PubMed:23300471]

(3) Jessica M Silvaggi et al. (2005) Small untranslated RNA antitoxin in Bacillus subtilis. Journal of Bacteriology 187(19):6641-50. [PubMed:16166525]

(4) Celine Reif et al. (2018) Bacillus subtilis Type I antitoxin SR6 Promotes Degradation of Toxin yonT mRNA and Is Required to Prevent Toxic yoyJ Overexpression. Toxins 10(2):74. [PubMed:29414903]

(5) Sylvain Durand et al. (2012) Type I toxin-antitoxin systems in Bacillus subtilis. RNA Biology 9(12):1491-7. [PubMed:23059907]


 experimental literature