Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrE/- |
Location | 2198883..2199100 | Replicon | chromosome |
Accession | NZ_CP101937 | ||
Organism | Bacillus subtilis strain RUB331 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | NP435_RS11315 | Protein ID | WP_009967515.1 |
Coordinates | 2198883..2199059 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2199000..2199100 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP435_RS11285 (2194071) | 2194071..2194298 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
NP435_RS11290 (2194559) | 2194559..2195875 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
NP435_RS11295 (2196232) | 2196232..2196738 | - | 507 | WP_004399486.1 | hypothetical protein | - |
NP435_RS11300 (2197066) | 2197066..2198298 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
NP435_RS11305 (2198380) | 2198380..2198568 | - | 189 | WP_004399547.1 | hypothetical protein | - |
NP435_RS11310 (2198613) | 2198613..2198864 | - | 252 | WP_010886546.1 | hypothetical protein | - |
NP435_RS11315 (2198883) | 2198883..2199059 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (2199000) | 2199000..2199100 | + | 101 | NuclAT_1 | - | Antitoxin |
- (2199000) | 2199000..2199100 | + | 101 | NuclAT_1 | - | Antitoxin |
- (2199000) | 2199000..2199100 | + | 101 | NuclAT_1 | - | Antitoxin |
- (2199000) | 2199000..2199100 | + | 101 | NuclAT_1 | - | Antitoxin |
NP435_RS11320 (2199434) | 2199434..2200045 | - | 612 | WP_009967516.1 | lipoprotein | - |
NP435_RS11325 (2200160) | 2200160..2200486 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
NP435_RS11330 (2201439) | 2201439..2201633 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2130725..2265507 | 134782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T253029 WP_009967515.1 NZ_CP101937:c2199059-2198883 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT253029 NZ_CP101937:2199000-2199100 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|