Detailed information of TA system TA296857

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2318915..2319205
• Replicon: chromosome
• Accession: NZ_OX419569
• Organism: Bacillus subtilis isolate NRS6118

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: KJP55_RS12010
• Protein ID: WP_009967548.1
• Coordinates: 2318915..2319031 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2319026..2319205 (-)

Genomic Context

Location: 2317477..2317812 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2318915..2319031 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2323534..2323668 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2314842..2315012 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2315309..2315626 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2315728..2316978 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2316971..2317303 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2317855..2318211 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2318217..2318684 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2319026..2319205 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2319026..2319205 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2319026..2319205 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2319026..2319205 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2319310..2319843 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2319879..2320457 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2320521..2321018 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2321027..2322742 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2322842..2323399 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KJP55_RS11975 (2314842)	2314842..2315012	-	171	WP_009967544.1	bacteriocin sublancin-168	-
KJP55_RS11980 (2315309)	2315309..2315626	-	318	WP_009967545.1	sublancin immunity protein SunI	-
KJP55_RS11985 (2315728)	2315728..2316978	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
KJP55_RS11990 (2316971)	2316971..2317303	-	333	WP_004398710.1	YolD-like family protein	-
KJP55_RS11995 (2317477)	2317477..2317812	+	336	WP_004399073.1	hypothetical protein	-
KJP55_RS12000 (2317855)	2317855..2318211	-	357	WP_004398595.1	hypothetical protein	-
KJP55_RS12005 (2318217)	2318217..2318684	-	468	WP_003246138.1	YolA family protein	-
KJP55_RS12010 (2318915)	2318915..2319031	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2319026)	2319026..2319205	-	180	NuclAT_1	-	Antitoxin
- (2319026)	2319026..2319205	-	180	NuclAT_1	-	Antitoxin
- (2319026)	2319026..2319205	-	180	NuclAT_1	-	Antitoxin
- (2319026)	2319026..2319205	-	180	NuclAT_1	-	Antitoxin
KJP55_RS12015 (2319310)	2319310..2319843	-	534	WP_004399156.1	GNAT family protein	-
KJP55_RS12020 (2319879)	2319879..2320457	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
KJP55_RS12025 (2320521)	2320521..2321018	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
KJP55_RS12030 (2321027)	2321027..2322742	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
KJP55_RS12035 (2322842)	2322842..2323399	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
KJP55_RS12040 (2323534)	2323534..2323668	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	2195159..2345976	150817

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T296857 WP_009967548.1 NZ_OX419569:2318915-2319031 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 180 bp

>AT296857 NZ_OX419569:c2319205-2319026 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin