Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
| Location | 2318915..2319205 | Replicon | chromosome |
| Accession | NZ_OX419569 | ||
| Organism | Bacillus subtilis isolate NRS6118 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | KJP55_RS12010 | Protein ID | WP_009967548.1 |
| Coordinates | 2318915..2319031 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2319026..2319205 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJP55_RS11975 (2314842) | 2314842..2315012 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| KJP55_RS11980 (2315309) | 2315309..2315626 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| KJP55_RS11985 (2315728) | 2315728..2316978 | - | 1251 | WP_004398504.1 | UV-damage repair protein uvrX | - |
| KJP55_RS11990 (2316971) | 2316971..2317303 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| KJP55_RS11995 (2317477) | 2317477..2317812 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| KJP55_RS12000 (2317855) | 2317855..2318211 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| KJP55_RS12005 (2318217) | 2318217..2318684 | - | 468 | WP_003246138.1 | YolA family protein | - |
| KJP55_RS12010 (2318915) | 2318915..2319031 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2319026) | 2319026..2319205 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2319026) | 2319026..2319205 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2319026) | 2319026..2319205 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2319026) | 2319026..2319205 | - | 180 | NuclAT_1 | - | Antitoxin |
| KJP55_RS12015 (2319310) | 2319310..2319843 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| KJP55_RS12020 (2319879) | 2319879..2320457 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| KJP55_RS12025 (2320521) | 2320521..2321018 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| KJP55_RS12030 (2321027) | 2321027..2322742 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| KJP55_RS12035 (2322842) | 2322842..2323399 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| KJP55_RS12040 (2323534) | 2323534..2323668 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2195159..2345976 | 150817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T296857 WP_009967548.1 NZ_OX419569:2318915-2319031 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT296857 NZ_OX419569:c2319205-2319026 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
