Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 1584514..1584731 | Replicon | chromosome |
Accession | NZ_CP120681 | ||
Organism | Bacillus subtilis strain DSM 10 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | P5655_RS08590 | Protein ID | WP_009967515.1 |
Coordinates | 1584514..1584690 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 1584631..1584731 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5655_RS08560 (1579701) | 1579701..1579928 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
P5655_RS08565 (1580189) | 1580189..1581505 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
P5655_RS08570 (1581862) | 1581862..1582368 | - | 507 | WP_004399486.1 | hypothetical protein | - |
P5655_RS08575 (1582697) | 1582697..1583929 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
P5655_RS08580 (1584011) | 1584011..1584199 | - | 189 | WP_004399547.1 | hypothetical protein | - |
P5655_RS08585 (1584244) | 1584244..1584495 | - | 252 | WP_010886546.1 | hypothetical protein | - |
P5655_RS08590 (1584514) | 1584514..1584690 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- (1584631) | 1584631..1584731 | + | 101 | NuclAT_2 | - | Antitoxin |
- (1584631) | 1584631..1584731 | + | 101 | NuclAT_2 | - | Antitoxin |
- (1584631) | 1584631..1584731 | + | 101 | NuclAT_2 | - | Antitoxin |
- (1584631) | 1584631..1584731 | + | 101 | NuclAT_2 | - | Antitoxin |
P5655_RS08595 (1585065) | 1585065..1585676 | - | 612 | WP_009967516.1 | lipoprotein | - |
P5655_RS08600 (1585791) | 1585791..1586117 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
P5655_RS08605 (1587070) | 1587070..1587264 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1516355..1665384 | 149029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T275357 WP_009967515.1 NZ_CP120681:c1584690-1584514 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT275357 NZ_CP120681:1584631-1584731 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|