Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 2212616..2212833 | Replicon | chromosome |
| Accession | NZ_CP125762 | ||
| Organism | Bacillus subtilis strain KRS015 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | O31941 |
| Locus tag | QLQ05_RS12190 | Protein ID | WP_009967515.1 |
| Coordinates | 2212616..2212792 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 2212733..2212833 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ05_RS12175 | 2210042..2210236 | - | 195 | WP_004399291.1 | hypothetical protein | - |
| QLQ05_RS12180 | 2211189..2211515 | + | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
| QLQ05_RS12185 | 2211630..2212241 | + | 612 | WP_009967516.1 | lipoprotein | - |
| - | 2212575..2212675 | - | 101 | NuclAT_4 | - | - |
| - | 2212575..2212675 | - | 101 | NuclAT_4 | - | - |
| - | 2212575..2212675 | - | 101 | NuclAT_4 | - | - |
| - | 2212575..2212675 | - | 101 | NuclAT_4 | - | - |
| QLQ05_RS12190 | 2212616..2212792 | + | 177 | WP_009967515.1 | hypothetical protein | Toxin |
| - | 2212733..2212833 | - | 101 | - | - | Antitoxin |
| QLQ05_RS12195 | 2212811..2213062 | + | 252 | WP_010886546.1 | hypothetical protein | - |
| QLQ05_RS12200 | 2213107..2213295 | + | 189 | WP_004399547.1 | hypothetical protein | - |
| QLQ05_RS12205 | 2213377..2214609 | + | 1233 | WP_004399445.1 | hypothetical protein | - |
| QLQ05_RS12210 | 2214937..2215443 | + | 507 | WP_004399486.1 | hypothetical protein | - |
| QLQ05_RS12215 | 2215800..2217116 | + | 1317 | WP_004399369.1 | hypothetical protein | - |
| QLQ05_RS12220 | 2217377..2217604 | + | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2012030..2280951 | 268921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T282378 WP_009967515.1 NZ_CP125762:2212616-2212792 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT282378 NZ_CP125762:c2212833-2212733 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|