Detailed information of TA system TA039045

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrG-as-bsrH/-
• Location: 2239409..2239699
• Replicon: chromosome
• Accession: NZ_AP024624
• Organism: Bacillus subtilis strain BEST3106

Toxin (Protein)

• Gene name: bsrG
• Uniprot ID: L8EAY0
• Locus tag: K6J91_RS11525
• Protein ID: WP_009967548.1
• Coordinates: 2239409..2239525 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	2239520..2239699 (-)

Genomic Context

Location: 2237971..2238306 (336 bp)
Type: Others
Protein ID: WP_004399073.1

Location: 2239409..2239525 (117 bp)
Type: Toxin
Protein ID: WP_009967548.1

Location: 2244028..2244162 (135 bp)
Type: Others
Protein ID: WP_234047931.1

Location: 2235336..2235506 (171 bp)
Type: Others
Protein ID: WP_009967544.1

Location: 2235803..2236120 (318 bp)
Type: Others
Protein ID: WP_009967545.1

Location: 2236222..2237472 (1251 bp)
Type: Others
Protein ID: WP_004398504.1

Location: 2237465..2237797 (333 bp)
Type: Others
Protein ID: WP_004398710.1

Location: 2238349..2238705 (357 bp)
Type: Others
Protein ID: WP_004398595.1

Location: 2238711..2239178 (468 bp)
Type: Others
Protein ID: WP_003246138.1

Location: 2239520..2239699 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239520..2239699 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239520..2239699 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239520..2239699 (180 bp)
Type: Antitoxin
Protein ID: NuclAT_1

Location: 2239804..2240337 (534 bp)
Type: Others
Protein ID: WP_004399156.1

Location: 2240373..2240951 (579 bp)
Type: Others
Protein ID: WP_004399123.1

Location: 2241015..2241512 (498 bp)
Type: Others
Protein ID: WP_003246188.1

Location: 2241521..2243236 (1716 bp)
Type: Others
Protein ID: WP_004398855.1

Location: 2243336..2243893 (558 bp)
Type: Others
Protein ID: WP_003246042.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
K6J91_RS11490 (2235336)	2235336..2235506	-	171	WP_009967544.1	bacteriocin sublancin-168	-
K6J91_RS11495 (2235803)	2235803..2236120	-	318	WP_009967545.1	sublancin immunity protein SunI	-
K6J91_RS11500 (2236222)	2236222..2237472	-	1251	WP_004398504.1	UV-damage repair protein uvrX	-
K6J91_RS11505 (2237465)	2237465..2237797	-	333	WP_004398710.1	YolD-like family protein	-
K6J91_RS11510 (2237971)	2237971..2238306	+	336	WP_004399073.1	hypothetical protein	-
K6J91_RS11515 (2238349)	2238349..2238705	-	357	WP_004398595.1	hypothetical protein	-
K6J91_RS11520 (2238711)	2238711..2239178	-	468	WP_003246138.1	YolA family protein	-
K6J91_RS11525 (2239409)	2239409..2239525	+	117	WP_009967548.1	type I toxin-antitoxin system toxin BsrG	Toxin
- (2239520)	2239520..2239699	-	180	NuclAT_1	-	Antitoxin
- (2239520)	2239520..2239699	-	180	NuclAT_1	-	Antitoxin
- (2239520)	2239520..2239699	-	180	NuclAT_1	-	Antitoxin
- (2239520)	2239520..2239699	-	180	NuclAT_1	-	Antitoxin
K6J91_RS11530 (2239804)	2239804..2240337	-	534	WP_004399156.1	GNAT family protein	-
K6J91_RS11535 (2240373)	2240373..2240951	-	579	WP_004399123.1	SMI1/KNR4 family protein	-
K6J91_RS11540 (2241015)	2241015..2241512	-	498	WP_003246188.1	SMI1/KNR4 family protein	-
K6J91_RS11545 (2241521)	2241521..2243236	-	1716	WP_004398855.1	ribonuclease YeeF family protein	-
K6J91_RS11550 (2243336)	2243336..2243893	-	558	WP_003246042.1	SMI1/KNR4 family protein	-
K6J91_RS11555 (2244028)	2244028..2244162	+	135	WP_234047931.1	transposase	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006323, TA006321, TA06323b, TA020252 2151626..2286408 0.003	inside	Prophage	-	-	2117443..2266470	149027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-38)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4336.39 Da
• Isoelectric Point: 10.1022

>T39045 WP_009967548.1 NZ_AP024624:2239409-2239525 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Nucleotide

• Length: 117 bp

>T39045 NZ_AP024624:2239409-2239525 [Bacillus subtilis]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG

Antitoxin

Nucleotide

• Length: 180 bp

>AT39045 NZ_AP024624:c2239699-2239520 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7Z7EVU9

Antitoxin