Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrH/- |
| Location | 2273227..2273517 | Replicon | chromosome |
| Accession | NZ_CP103066 | ||
| Organism | Bacillus subtilis strain 0137 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | NXS96_RS11755 | Protein ID | WP_009967548.1 |
| Coordinates | 2273227..2273343 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrH | ||
| Locus tag | - | ||
| Coordinates | 2273338..2273517 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NXS96_RS11720 (2269158) | 2269158..2269328 | - | 171 | WP_009967544.1 | bacteriocin sublancin-168 | - |
| NXS96_RS11725 (2269625) | 2269625..2269942 | - | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
| NXS96_RS11730 (2270044) | 2270044..2271290 | - | 1247 | Protein_2259 | UV damage repair protein UvrX | - |
| NXS96_RS11735 (2271283) | 2271283..2271615 | - | 333 | WP_004398710.1 | YolD-like family protein | - |
| NXS96_RS11740 (2271789) | 2271789..2272124 | + | 336 | WP_004399073.1 | hypothetical protein | - |
| NXS96_RS11745 (2272167) | 2272167..2272523 | - | 357 | WP_004398595.1 | hypothetical protein | - |
| NXS96_RS11750 (2272529) | 2272529..2272996 | - | 468 | WP_003246138.1 | YolA family protein | - |
| NXS96_RS11755 (2273227) | 2273227..2273343 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| - (2273338) | 2273338..2273517 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273338) | 2273338..2273517 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273338) | 2273338..2273517 | - | 180 | NuclAT_1 | - | Antitoxin |
| - (2273338) | 2273338..2273517 | - | 180 | NuclAT_1 | - | Antitoxin |
| NXS96_RS11760 (2273622) | 2273622..2274155 | - | 534 | WP_004399156.1 | GNAT family protein | - |
| NXS96_RS11765 (2274191) | 2274191..2274769 | - | 579 | WP_004399123.1 | SMI1/KNR4 family protein | - |
| NXS96_RS11770 (2274833) | 2274833..2275330 | - | 498 | WP_003246188.1 | SMI1/KNR4 family protein | - |
| NXS96_RS11775 (2275339) | 2275339..2277054 | - | 1716 | WP_004398855.1 | ribonuclease YeeF family protein | - |
| NXS96_RS11780 (2277154) | 2277154..2277711 | - | 558 | WP_003246042.1 | SMI1/KNR4 family protein | - |
| NXS96_RS11785 (2277846) | 2277846..2277980 | + | 135 | WP_234047931.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2151265..2286041 | 134776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T254841 WP_009967548.1 NZ_CP103066:2273227-2273343 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 180 bp
>AT254841 NZ_CP103066:c2273517-2273338 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
