Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrH/-
Location 2291604..2291894 Replicon chromosome
Accession NZ_LN649259
Organism Bacillus subtilis strain BS49

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag VV34_RS23645 Protein ID WP_009967548.1
Coordinates 2291604..2291720 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 2291715..2291894 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VV34_RS11865 2287531..2287701 - 171 WP_009967544.1 bacteriocin sublancin-168 -
VV34_RS11870 2287998..2288315 - 318 WP_009967545.1 sublancin immunity protein SunI -
VV34_RS11875 2288417..2289667 - 1251 WP_004398504.1 UV-damage repair protein uvrX -
VV34_RS11880 2289660..2289992 - 333 WP_004398710.1 YolD-like family protein -
VV34_RS11885 2290166..2290501 + 336 WP_004399073.1 hypothetical protein -
VV34_RS11890 2290544..2290900 - 357 WP_004398595.1 hypothetical protein -
VV34_RS11895 2290906..2291373 - 468 WP_003246138.1 YolA family protein -
VV34_RS23645 2291604..2291720 + 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
- 2291715..2291894 - 180 NuclAT_1 - Antitoxin
- 2291715..2291894 - 180 NuclAT_1 - Antitoxin
- 2291715..2291894 - 180 NuclAT_1 - Antitoxin
- 2291715..2291894 - 180 NuclAT_1 - Antitoxin
VV34_RS11905 2291999..2292532 - 534 WP_004399156.1 GNAT family N-acetyltransferase -
VV34_RS11910 2292568..2293146 - 579 WP_004399123.1 SMI1/KNR4 family protein -
VV34_RS11915 2293210..2293707 - 498 WP_003246188.1 SMI1/KNR4 family protein -
VV34_RS11920 2293716..2295431 - 1716 WP_004398855.1 ribonuclease YeeF family protein -
VV34_RS11925 2295531..2296088 - 558 WP_003246042.1 SMI1/KNR4 family protein -
VV34_RS22950 2296157..2296357 + 201 WP_161793078.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2169638..2304418 134780


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T285513 WP_009967548.1 NZ_LN649259:2291604-2291720 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 180 bp

>AT285513 NZ_LN649259:c2291894-2291715 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References