Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrG/- |
Location | 2078437..2078654 | Replicon | chromosome |
Accession | NZ_CP125762 | ||
Organism | Bacillus subtilis strain KRS015 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | QLQ05_RS11200 | Protein ID | WP_009967515.1 |
Coordinates | 2078478..2078654 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2078437..2078537 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ05_RS11185 (2075904) | 2075904..2076098 | - | 195 | WP_004399291.1 | hypothetical protein | - |
QLQ05_RS11190 (2077051) | 2077051..2077377 | + | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
QLQ05_RS11195 (2077492) | 2077492..2078103 | + | 612 | WP_009967516.1 | lipoprotein | - |
- (2078437) | 2078437..2078537 | - | 101 | NuclAT_5 | - | Antitoxin |
- (2078437) | 2078437..2078537 | - | 101 | NuclAT_5 | - | Antitoxin |
- (2078437) | 2078437..2078537 | - | 101 | NuclAT_5 | - | Antitoxin |
- (2078437) | 2078437..2078537 | - | 101 | NuclAT_5 | - | Antitoxin |
QLQ05_RS11200 (2078478) | 2078478..2078654 | + | 177 | WP_009967515.1 | hypothetical protein | Toxin |
QLQ05_RS11205 (2078673) | 2078673..2078924 | + | 252 | WP_010886546.1 | hypothetical protein | - |
QLQ05_RS11210 (2078969) | 2078969..2079157 | + | 189 | WP_004399547.1 | hypothetical protein | - |
QLQ05_RS11215 (2079239) | 2079239..2080471 | + | 1233 | WP_004399445.1 | hypothetical protein | - |
QLQ05_RS11220 (2080799) | 2080799..2081305 | + | 507 | WP_004399486.1 | hypothetical protein | - |
QLQ05_RS11225 (2081662) | 2081662..2082978 | + | 1317 | WP_004399369.1 | hypothetical protein | - |
QLQ05_RS11230 (2083239) | 2083239..2083466 | + | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2012030..2280951 | 268921 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T282360 WP_009967515.1 NZ_CP125762:2078478-2078654 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT282360 NZ_CP125762:c2078537-2078437 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCATTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|