Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) bsrG-as-bsrH/-
Location 2882417..2882707 Replicon chromosome
Accession NZ_CP120613
Organism Bacillus subtilis strain DSM 23521

Toxin (Protein)


Gene name bsrG Uniprot ID L8EAY0
Locus tag P5649_RS15215 Protein ID WP_009967548.1
Coordinates 2882591..2882707 (-) Length 39 a.a.

Antitoxin (RNA)


Gene name as-bsrH
Locus tag -
Coordinates 2882417..2882596 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5649_RS15185 (2877954) 2877954..2878088 - 135 WP_234047931.1 transposase -
P5649_RS15190 (2878223) 2878223..2878780 + 558 WP_003246042.1 SMI1/KNR4 family protein -
P5649_RS15195 (2878880) 2878880..2880595 + 1716 WP_004398855.1 ribonuclease YeeF family protein -
P5649_RS15200 (2880604) 2880604..2881101 + 498 WP_003246188.1 SMI1/KNR4 family protein -
P5649_RS15205 (2881165) 2881165..2881743 + 579 WP_004399123.1 SMI1/KNR4 family protein -
P5649_RS15210 (2881779) 2881779..2882312 + 534 WP_004399156.1 GNAT family protein -
- (2882417) 2882417..2882596 + 180 NuclAT_1 - Antitoxin
- (2882417) 2882417..2882596 + 180 NuclAT_1 - Antitoxin
- (2882417) 2882417..2882596 + 180 NuclAT_1 - Antitoxin
- (2882417) 2882417..2882596 + 180 NuclAT_1 - Antitoxin
P5649_RS15215 (2882591) 2882591..2882707 - 117 WP_009967548.1 type I toxin-antitoxin system toxin BsrG Toxin
P5649_RS15220 (2882938) 2882938..2883405 + 468 WP_003246138.1 YolA family protein -
P5649_RS15225 (2883411) 2883411..2883767 + 357 WP_004398595.1 hypothetical protein -
P5649_RS15230 (2883810) 2883810..2884145 - 336 WP_004399073.1 hypothetical protein -
P5649_RS15235 (2884319) 2884319..2884651 + 333 WP_004398710.1 YolD-like family protein -
P5649_RS15240 (2884644) 2884644..2885894 + 1251 WP_004398504.1 UV-damage repair protein uvrX -
P5649_RS15245 (2885996) 2885996..2886313 + 318 WP_009967545.1 sublancin immunity protein SunI -
P5649_RS15250 (2886610) 2886610..2886780 + 171 WP_009967544.1 bacteriocin sublancin-168 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2855647..3004673 149026


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(1-38)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4336.39 Da        Isoelectric Point: 10.1022

>T275255 WP_009967548.1 NZ_CP120613:c2882707-2882591 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK

Download         Length: 117 bp

Antitoxin


Download         Length: 180 bp

>AT275255 NZ_CP120613:2882417-2882596 [Bacillus subtilis]
AATGATACAATTATATAATTATTTTTTGCATTTTGTTTAATTAAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCAC
CCTGGCTCTGTACAAAAGCTGCCCATCAAAGGGCTTGCTCGTTGTCAAATCTGCGTAGGCCTAACCCTTCAGGTGTCCAA
ACTCAAGGGAAGGTCTATTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7EVU9

Antitoxin

Download structure file

References