Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 2185577..2185794 | Replicon | chromosome |
Accession | NZ_AP024626 | ||
Organism | Bacillus subtilis strain BEST3125 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | O31941 |
Locus tag | K6K02_RS11195 | Protein ID | WP_009967515.1 |
Coordinates | 2185618..2185794 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 2185577..2185677 (+) |
Genomic Context
Location: 2185577..2185677 (101 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2185735..2185835 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2185735..2185835 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2185735..2185835 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2185735..2185835 (101 bp)
Type: Others
Protein ID: NuclAT_2
Type: Others
Protein ID: NuclAT_2
Location: 2188174..2188368 (195 bp)
Type: Others
Protein ID: WP_004399291.1
Type: Others
Protein ID: WP_004399291.1
Location: 2180806..2181033 (228 bp)
Type: Others
Protein ID: WP_004399298.1
Type: Others
Protein ID: WP_004399298.1
Location: 2181294..2182610 (1317 bp)
Type: Others
Protein ID: WP_004399369.1
Type: Others
Protein ID: WP_004399369.1
Location: 2182967..2183473 (507 bp)
Type: Others
Protein ID: WP_004399486.1
Type: Others
Protein ID: WP_004399486.1
Location: 2183801..2185033 (1233 bp)
Type: Others
Protein ID: WP_004399445.1
Type: Others
Protein ID: WP_004399445.1
Location: 2185115..2185303 (189 bp)
Type: Others
Protein ID: WP_004399547.1
Type: Others
Protein ID: WP_004399547.1
Location: 2185348..2185599 (252 bp)
Type: Others
Protein ID: WP_010886546.1
Type: Others
Protein ID: WP_010886546.1
Location: 2185618..2185794 (177 bp)
Type: Toxin
Protein ID: WP_009967515.1
Type: Toxin
Protein ID: WP_009967515.1
Location: 2186169..2186780 (612 bp)
Type: Others
Protein ID: WP_009967516.1
Type: Others
Protein ID: WP_009967516.1
Location: 2186895..2187221 (327 bp)
Type: Others
Protein ID: WP_009967517.1
Type: Others
Protein ID: WP_009967517.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6K02_RS11165 | 2180806..2181033 | - | 228 | WP_004399298.1 | helix-turn-helix transcriptional regulator | - |
K6K02_RS11170 | 2181294..2182610 | - | 1317 | WP_004399369.1 | hypothetical protein | - |
K6K02_RS11175 | 2182967..2183473 | - | 507 | WP_004399486.1 | hypothetical protein | - |
K6K02_RS11180 | 2183801..2185033 | - | 1233 | WP_004399445.1 | hypothetical protein | - |
K6K02_RS11185 | 2185115..2185303 | - | 189 | WP_004399547.1 | hypothetical protein | - |
K6K02_RS11190 | 2185348..2185599 | - | 252 | WP_010886546.1 | hypothetical protein | - |
- | 2185577..2185677 | + | 101 | - | - | Antitoxin |
K6K02_RS11195 | 2185618..2185794 | - | 177 | WP_009967515.1 | hypothetical protein | Toxin |
- | 2185735..2185835 | + | 101 | NuclAT_2 | - | - |
- | 2185735..2185835 | + | 101 | NuclAT_2 | - | - |
- | 2185735..2185835 | + | 101 | NuclAT_2 | - | - |
- | 2185735..2185835 | + | 101 | NuclAT_2 | - | - |
K6K02_RS11200 | 2186169..2186780 | - | 612 | WP_009967516.1 | lipoprotein | - |
K6K02_RS11205 | 2186895..2187221 | - | 327 | WP_009967517.1 | helix-turn-helix transcriptional regulator | - |
K6K02_RS11210 | 2188174..2188368 | + | 195 | WP_004399291.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2117462..2266489 | 149027 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6882.45 Da Isoelectric Point: 12.8833
>T39084 WP_009967515.1 NZ_AP024626:c2185794-2185618 [Bacillus subtilis]
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T39084 NZ_AP024626:c2185794-2185618 [Bacillus subtilis]
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
GTGCTTGAGAAAATGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCCGATGA
Antitoxin
Download Length: 101 bp
>AT39084 NZ_AP024626:2185577-2185677 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | O31941 |
Antitoxin
Download structure file